(data stored in ACNUC7421 zone)

EMBL: AP010803.PE472

AP010803.PE472       Location/Qualifiers
FT   CDS_pept        complement(479475..480221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxR"
FT                   /locus_tag="SJA_C1-04720"
FT                   /product="LuxR-family transcriptional regulator"
FT                   /note="DNA-binding HTH domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04720"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95306"
FT                   /db_xref="GOA:D4YY74"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY74"
FT                   /protein_id="BAI95306.1"
FT                   /translation="MMIGLGQVQDFCAVAGAIKDATALSDLMAEITKAMGFRHYALVHH
FT                   VDLKPAVRSVHIVDYPQDWVERFQARRLYASDPIHRASHRTNVGFAWSAVQSIISLTAA
FT                   DRSILAEAYEAGLGDGFTVPAHIPGELNGSCSFAMAAGEMLDHRQLPFVQLVGSFAFEA
FT                   ARKISRIHAPQSEWPSLTERQAECVALVARGKTDWEISQILGIGQETVIQHVKDARDRY
FT                   GVTKRTLLAIRALFDGQISFADVFGR"
     atgatgatcg ggcttgggca agttcaggat ttctgcgctg tcgctggcgc gatcaaggac        60
     gctacggcct tgtctgacct gatggccgaa atcacgaagg ccatgggctt tcggcactat       120
     gccctggtcc atcatgtcga cctgaagcct gcggttcgct cggtccacat cgtcgactat       180
     ccgcaagact gggtggagcg cttccaggcg agacgcctct atgcgagcga cccgatccac       240
     cgcgccagcc atcgcaccaa tgtgggcttt gcctggtcgg cggttcagtc gatcatctct       300
     ctgacggccg ccgatcgctc gatcctggca gaagcctacg aggccgggct gggcgacggc       360
     ttcaccgttc cggcccatat tcctggcgag ctcaatggat cctgttcctt cgcgatggcg       420
     gcgggcgaga tgctcgacca tcggcagctg ccgttcgtgc agctcgtcgg cagcttcgcg       480
     ttcgaagcgg cacgcaagat ttcccggatc cacgcgccgc aatccgaatg gccgagcctg       540
     accgaaaggc aggccgaatg cgtggcgctg gtcgcgcggg gcaagaccga ttgggagatc       600
     agccagatcc tcggcatcgg ccaggaaacg gtgatccagc atgtgaagga tgcgcgcgac       660
     cgctatggcg tcaccaagcg caccctcctc gccattcgcg ccttgttcga cgggcaaatc       720
     agctttgccg atgtgttcgg ccgatga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page