(data stored in SCRATCH zone)

EMBL: AP010803.PE473

AP010803.PE473       Location/Qualifiers
FT   CDS_pept        complement(480235..480996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxR"
FT                   /locus_tag="SJA_C1-04730"
FT                   /product="LuxR-family transcriptional regulator"
FT                   /note="DNA-binding HTH domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04730"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95307"
FT                   /db_xref="GOA:D4YY75"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY75"
FT                   /protein_id="BAI95307.1"
FT                   /translation="MANRIKDCGRLDDLTRFATDCQRAETLGDLHGTIDAAVRDLGFRW
FT                   FTLLHNIDLRRGDEQSLFLTTYPSAWLEEVLEERHYIEDPIHAACARTPSGLAWDRVGD
FT                   MLELTPRQRGILDRARDHDLASGYSLPIRTPGEPEAIFTAARSRDEPLSAEEVLTARLL
FT                   GSVAYDRARELLGERAGPLACVPLSPRQVECIALVAQGKSDWEIGQILGLSRDTVHEYV
FT                   ESARRRYGVRRRTQLVLRAVRDGHLNMEALL"
     atggcgaaca ggataaaaga ctgcggccgc cttgatgatc tcacgcgctt tgcgacagac        60
     tgtcagcgtg ctgaaaccct tggcgatctg catggcacga tcgatgccgc cgtgcgcgat       120
     cttggcttcc gctggttcac gctgcttcac aatatcgacc ttcggcgcgg cgacgagcaa       180
     agcctgttcc tcacaaccta tccgtcggcc tggctcgagg aagttctaga agaacgccac       240
     tatatcgaag atcccattca tgcggcctgc gcacgtacgc cctctggact ggcctgggac       300
     cgtgtcggcg acatgctgga gctcacgccg cgccagcgag gcatccttga ccgcgcccgg       360
     gatcatgacc ttgcatcggg ctacagtttg ccgatccgga ctccgggcga gcccgaggcg       420
     atcttcactg cggcccgatc acgcgacgag ccgctgagtg cagaagaggt tctgaccgcc       480
     cgtctgctcg gctcggtcgc ttatgatcgg gcgcgcgagc tgcttggcga aagggcaggg       540
     ccattggcct gcgtccctct cagccctcgc caggtcgaat gcatcgcgct cgtcgcgcaa       600
     ggcaaaagcg actgggagat cggccagatc ctcggcctca gccgcgacac cgtgcacgaa       660
     tatgttgaat cggcccgcag gcgttatggc gtgcgacgac gcacgcagct ggtgctgcgc       720
     gcggttcgcg atggtcatct caacatggaa gcgctgctct ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page