(data stored in ACNUC7421 zone)

EMBL: AP010803.PE474

AP010803.PE474       Location/Qualifiers
FT   CDS_pept        481218..481787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04740"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95308"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY76"
FT                   /protein_id="BAI95308.1"
FT                   /translation="MFHAGKPLEPSIGCDVAAVLETLATVSSRPRYAFMLLNLIAQVAG
FT                   PDGSAGPWVRRNDGLVSLRDWLCDALTPMAQRGPRSITLAERVESDLARNGLLPGDPEK
FT                   RRGVIAEEMRARIRTAGKSNLSRAVSELVNAGLLRRHYQGYRVDHRNRGGQRHAVYTLI
FT                   GDALRLVPGISSTPNLPVQGELALPR"
     atgtttcatg caggcaagcc tcttgaaccc tccattggct gtgatgtcgc ggccgtgctc        60
     gagacgctgg cgaccgtatc gagccggccc cgttatgcct tcatgctgct caacctgatc       120
     gcccaggtgg cggggccaga tggaagcgcc ggtccctggg tcaggcggaa cgatgggctc       180
     gtttccctgc gcgattggct atgcgacgca ttgaccccga tggcccagcg tggtccgcgc       240
     agcattacgc tggccgagcg ggtcgagagc gacctcgcta gaaacggact gctccccggc       300
     gatccggaga aaaggcgcgg cgtgatcgcg gaggaaatgc gggcacgcat tcgcacagcc       360
     ggcaagagta atctcagtcg cgccgtttcc gaactggtga atgcaggcct gctccgccga       420
     cattatcagg gctatcgcgt cgaccatcgg aaccgtggcg gccagcgcca cgccgtctat       480
     accttgatcg gcgatgctct gcgtctagtg ccgggcatca gctccacacc gaatctgccc       540
     gtgcaaggcg aacttgccct cccaagatga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page