(data stored in ACNUC7421 zone)

EMBL: AP010803.PE475

AP010803.PE475       Location/Qualifiers
FT   CDS_pept        complement(481897..482577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04750"
FT                   /product="putative protein-S-isoprenylcysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04750"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95309"
FT                   /db_xref="GOA:D4YY77"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY77"
FT                   /protein_id="BAI95309.1"
FT                   /translation="MTHADYGYGLWGLALVNAAVFILFAFSFFKPATRRDWRSFGAFSA
FT                   FIVALFAEMYGFPLTIFLLSGWLQSHFPAVDWWSHDAGHLLEMMFGWRVNPHYGPFHIA
FT                   SFVLIGVGYWLISVAWTALHLSQRKHQLALTGIYARIRHPQYVGFILVMLGFLLQWPTL
FT                   LTLAMFPVLVVMYIRLARHEEKEALANFGEVYRDYMARVPGFIPNLTIHSRRRRPWRSF
FT                   DGNG"
     atgacgcacg ccgactatgg ctatggtctg tgggggctcg cgctggtcaa tgccgccgtt        60
     ttcatcctct ttgcgttcag cttcttcaag ccggcaacgc ggcgcgactg gcgcagcttc       120
     ggcgcgttca gtgcgttcat cgtcgcgctc ttcgccgaaa tgtatggctt cccgctcacg       180
     atcttcctgc tgtcggggtg gctccagtcg catttccccg ctgtcgactg gtggagccac       240
     gatgctggac atctcctgga gatgatgttc ggctggcgag ttaatcccca ttacggtcca       300
     ttccacatcg ccagctttgt gctgatcggc gtgggttact ggctgatctc ggttgcatgg       360
     acggcccttc acttgagtca gcgcaaacac caattggccc ttactgggat ttatgcccgg       420
     atccggcacc cgcaatatgt cggcttcatt ctcgtcatgc tcggcttttt gctacaatgg       480
     ccgacccttt tgacccttgc tatgtttccg gtgctcgtcg tgatgtatat tcggctggct       540
     cggcatgagg aaaaggaggc gctagccaac ttcggcgagg tttaccgcga ttatatggct       600
     cgcgtgcccg gcttcattcc gaatctgaca atccattcgc gtcgaagaag gccatggcga       660
     tcctttgacg ggaatggctg a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page