(data stored in SCRATCH zone)

EMBL: AP010803.PE476

AP010803.PE476       Location/Qualifiers
FT   CDS_pept        complement(482574..482837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04760"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95310"
FT                   /db_xref="GOA:D4YY78"
FT                   /db_xref="InterPro:IPR021682"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY78"
FT                   /protein_id="BAI95310.1"
FT                   /translation="MGEHDHRMRKRGKIVLIGFLLVASFFLITEHTAHFLGVLPYLILL
FT                   ACPLMHLFMHHGQGGHQHGHEPGQAPAGLPANPNGRIEGESR"
     atgggcgaac atgaccatcg catgcgcaag cgcggcaaga tcgttctgat cggcttcctg        60
     ctcgtcgcca gcttcttcct cattaccgag cataccgcgc acttcctggg tgtgctgccc       120
     tatctcatcc tgctcgcctg cccgctcatg cacctgttca tgcaccacgg ccaaggtggg       180
     catcagcatg gccatgagcc cggccaggca cccgccggct tgccggccaa tcccaacggc       240
     cgcatcgaag gagagtcgcg atga                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page