(data stored in SCRATCH zone)

EMBL: AP010803.PE48

AP010803.PE48        Location/Qualifiers
FT   CDS_pept        50471..50953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00480"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94882"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX00"
FT                   /protein_id="BAI94882.1"
FT                   /translation="MRIVLALALMLAACSKSSDVLEELPNSSLAGAAREDVPETRLESR
FT                   LVRPVTIGEDGPRLDACGAMGQAARVGAGGAPVRAAPFSDAREIARMAEGARAWVCTRS
FT                   LDQKWLGVVLVAEPPADNATAPVDCGVSEPADRKQPYDGPCLSGWVSSAAIRLIAG"
     atgcgcattg tccttgccct ggccctgatg ctcgccgcct gctcgaaaag cagcgacgtg        60
     ctggaggaat tgcccaacag ttccctggcc ggcgcggcgc gggaggatgt gccggaaacc       120
     cgcctggaat cgcgcctcgt ccgacccgtg accatcgggg aggacggtcc gcgtctggac       180
     gcctgcggcg ccatggggca ggcggcgcgc gtgggcgccg gaggagcgcc ggtacgggcc       240
     gcgccctttt cggacgcccg ggaaatcgcc cgcatggcgg agggcgcccg cgcctgggtc       300
     tgcacccgca gcctcgacca gaaatggctg ggggtcgtgc tggtcgctga gcctcctgcc       360
     gacaatgcga cggctccggt ggattgcggc gtttccgaac cggcggaccg caagcagccc       420
     tatgacggcc cctgcctcag cggctgggta tccagcgccg cgatcaggct gatcgcaggt       480
     tag                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page