(data stored in ACNUC7421 zone)

EMBL: AP010803.PE481

AP010803.PE481       Location/Qualifiers
FT   CDS_pept        487552..488187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04810"
FT                   /product="CheY-like response regulator"
FT                   /note="response regulator containing a CheY-like receiver
FT                   domain and an HTH DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04810"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95315"
FT                   /db_xref="GOA:D4YY83"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY83"
FT                   /protein_id="BAI95315.1"
FT                   /translation="MGNKRVVHIVDDEETIRKALSFTLRTAGFAVEAYASGPEFLLSAE
FT                   DAEKGCVVLDMHMPDMDGLQVQAELTRRGIDMPVVVLTGNGDPTLAVQAMKAGAADFLA
FT                   KPVEKAALLGAIDRGFSWLESIARRASEQADALSKAARLTQRERAVLRGISRGYPNSLI
FT                   ADELGVTSRTVELHRASLMIKLNAQSLPDLLRIAFAVDLHESTENGHP"
     atggggaaca agcgcgtcgt gcatatcgtc gatgacgaag agacaatacg aaaagcacta        60
     agtttcacgt tgcggaccgc agggtttgcc gtagaagcct acgcttcggg gccggagttt       120
     ctgttgagcg cagaggacgc cgagaaaggc tgcgtggttc tcgacatgca catgcccgac       180
     atggacggcc tgcaggttca ggcggagctg acgcgacgcg gtatcgacat gcccgtcgtg       240
     gtgctgacgg gcaatggcga tcctacgctc gccgtacagg cgatgaaggc gggcgctgcc       300
     gactttctcg ccaaaccggt cgagaaggcc gcattgctcg gcgcgatcga ccgcggcttc       360
     agctggcttg agagtatagc ccgtcgtgcc tccgaacagg ccgacgctct ttcgaaagcc       420
     gcgagactga cgcagcgcga acgggccgtt ctgagaggaa tttcgcgagg ctatccaaat       480
     agccttatcg cagatgaact cggcgtcacg tcgcgcacgg tcgagctgca tcgggccagt       540
     ctgatgatca aactcaacgc gcaaagcctg cccgacctgt tgcggatcgc tttcgccgtc       600
     gacctgcacg aatcgaccga aaacgggcac ccctaa                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page