(data stored in ACNUC7421 zone)

EMBL: AP010803.PE487

AP010803.PE487       Location/Qualifiers
FT   CDS_pept        493240..493512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04870"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95321"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY89"
FT                   /protein_id="BAI95321.1"
FT                   /translation="MDELDHLLSRLRDAPLDPRLGGLESRVMAEIARIQAIPRLGATTF
FT                   GIAAATALFIGIAGSAVPTQSADPNPISPFDARLALAPSTLLSSQ"
     atggatgaac ttgaccacct gctctcgcgg ttgcgcgatg cgcctctcga tcccaggctc        60
     ggcggtctgg aaagccgggt catggcggaa atagcgcgca tccaggccat accgcgcctt       120
     ggcgcaacga cattcggcat cgcggccgca accgcgctgt tcatcggaat tgccggctcg       180
     gcggttccga cgcagtctgc cgatccgaac ccgatatcgc ccttcgatgc ccggctcgcg       240
     cttgcgccct cgacgctact gagctcgcaa tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page