(data stored in SCRATCH zone)

EMBL: AP010803.PE488

AP010803.PE488       Location/Qualifiers
FT   CDS_pept        493509..493952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04880"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95322"
FT                   /db_xref="InterPro:IPR025961"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY90"
FT                   /protein_id="BAI95322.1"
FT                   /translation="MMRDRRRLLLLVLLTFAAAIAGVVIGRVYVVPVRPVENELHELLH
FT                   RDLKLDSAQHSRLETIEKNYAIRRQALEAELRADNARLAEAIEAEHGYGPQVAAAVDRS
FT                   HQAMGALQKETLEHIFAMRAVLRPDQTEKFDDAVVKALTAKSK"
     atgatgcgcg accgccgccg gctcctgctc ctcgtcctgt tgaccttcgc cgcggcgatc        60
     gctggcgttg tcatcggccg cgtctatgtg gttccagtgc gcccggtcga aaatgagctg       120
     cacgagctgc tccatcgcga tctgaagctg gattccgcgc aacacagccg gctcgagaca       180
     atcgagaaga actacgccat acggcgtcaa gcgctggagg ccgaactgcg cgccgacaat       240
     gcgcgcctcg cggaggcgat cgaagcggag catggctatg gcccgcaagt cgcagcggcg       300
     gtggatcgct cgcaccaggc catgggcgcc ctgcagaagg aaacgctcga gcacatcttc       360
     gcaatgcggg ccgtgctgcg tcccgatcag accgagaagt tcgacgacgc cgtcgtgaaa       420
     gcgctgacgg ccaagtccaa atga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page