(data stored in ACNUC7421 zone)

EMBL: AP010803.PE49

AP010803.PE49        Location/Qualifiers
FT   CDS_pept        complement(50998..51504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00490"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00490"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94883"
FT                   /db_xref="InterPro:IPR018531"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX01"
FT                   /protein_id="BAI94883.1"
FT                   /translation="MATDLYDLTVPVFIRGLRNLSAILEKGAAYAEEKGIDPLTLTQAR
FT                   LTQDMAPLAAQVQYASDSAKGAVIRIGGLDPVPMPDTEQSFADLQERIGKTLAFLESVP
FT                   RDRIDGREDAQVVLRTPRGDFSFTGRSHVLGFSMPNFHFHVTMAYALLRQAGVPLGKLD
FT                   YLGGL"
     gtggcgaccg acctgtacga cctgaccgtt cccgtcttca tccggggcct gcgcaatctt        60
     tccgccatcc tggagaaggg cgcggcctat gcggaagaaa aggggatcga tccactcacg       120
     ctgacgcagg cgcggctcac gcaggacatg gccccgctcg ccgcgcaggt gcaatatgcc       180
     agcgacagcg cgaagggggc ggtgatccgc atcggcgggc tcgatccggt gccgatgccc       240
     gatacggagc agagctttgc cgacctccag gaacggatcg gcaagaccct cgccttcctg       300
     gaatccgtcc cgcgcgatcg gatcgacggg cgggaggacg cgcaagtggt gctcaggacg       360
     ccgcgcggcg acttctcctt caccgggcgc agccatgtgc tgggcttctc catgcccaat       420
     ttccacttcc atgtgacgat ggcctatgcg ctgctgcggc aggcgggcgt gccgctgggc       480
     aagctcgatt atctgggcgg gctttaa                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page