(data stored in ACNUC7421 zone)

EMBL: AP010803.PE492

AP010803.PE492       Location/Qualifiers
FT   CDS_pept        497764..498237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04920"
FT                   /product="hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04920"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95326"
FT                   /db_xref="GOA:D4YY94"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY94"
FT                   /protein_id="BAI95326.1"
FT                   /translation="MDHSSHMNTRKMGAYWSLAVQTVISGVIMYLVMFVMIDGLDSFYN
FT                   NLNMLYMTLMMVAPMVVLMILAMRHMFASKAANIALIAASLVAFFGSFALIRTQTTIGD
FT                   TAFLRSMIPHHSGAILMCQEAKLSDPEVIRLCESIKRSQRQEIDEMKAILARR"
     atggaccatt cgtcccacat gaacacccgg aagatgggcg cctattggag ccttgccgtt        60
     cagaccgtca tcagcggcgt catcatgtat ctggtgatgt tcgtcatgat cgacgggctc       120
     gacagcttct acaacaacct caacatgctc tacatgacgc tgatgatggt cgcaccgatg       180
     gtagtgctga tgatcctcgc catgcggcac atgtttgcgt cgaaggccgc caacatcgcg       240
     ctgatcgccg cctcgctggt cgccttcttc ggcagcttcg cgcttatccg cacccagacc       300
     acgatcggcg acacggcctt tctgcgctcg atgatcccgc accattccgg ggcgatcctg       360
     atgtgccagg aagcaaagct cagcgatccg gaagtcatcc ggctctgcga atcgatcaag       420
     cgctcgcagc ggcaggaaat cgacgagatg aaggccattc tcgcgcggcg ctga             474
//

If you have problems or comments...

PBIL Back to PBIL home page