(data stored in ACNUC7421 zone)

EMBL: AP010803.PE493

AP010803.PE493       Location/Qualifiers
FT   CDS_pept        498296..499831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04930"
FT                   /product="signal transduction histidine kinase"
FT                   /note="two-component system, NtrC family, sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04930"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95327"
FT                   /db_xref="GOA:D4YY95"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY95"
FT                   /protein_id="BAI95327.1"
FT                   /translation="MVDTRRGADEIASDVARLAPLFLRQAGGHVLTLLDPSGIVLSYNE
FT                   EGERAECWPLDRVLGQPHDLFYPPDEIAAGRPGADLAAALHEGTLEREAWRVCENGAEY
FT                   LARLTITALFEGDTHRGFACISRDVTDEAAVRASIETREQHLQSILATVPDAMIIIDET
FT                   GAITSFSAAAQRLFGYSEAELVGRNVSCLMPQPDRDRHDEYLAHYLQTGERRIIGLGRV
FT                   VVGQRRDGSTFPMQLSVGEAGEDGQRLFTGFIRDLTAKEQDELRLKELQAELVHVSRLS
FT                   AMGTMASTLAHELNQPLAAVALYLETIRDMLDERDDEPFVSLRSVMDDAAQETLRAGHI
FT                   VRRLRDFVARGEVDKSLHELPQVIAEASQLALVGARERGIRSFFAVDPAATPVLVDRVQ
FT                   IQQVLVNLMRNAIEAMAECPVRDLKVATRLRPDGLIEVTVEDTGPGIADGIREQLFTAF
FT                   NSTKADGMGLGLSICRTIIEAHGGRIWMERPDRGGTRFHFTLIHARAEEEHGG"
     atggtcgaca cgaggcgcgg ggcggacgag attgcaagcg acgtagcgcg gcttgcgccg        60
     ctgttcctgc gacaggctgg cggccacgtc ctgacgctgc tcgatccttc cgggatcgtg       120
     ctgagctata atgaagaagg cgagcgtgcc gaatgctggc cgctcgatcg cgtcctggga       180
     cagccccacg acctgttcta cccgcccgac gagattgcgg cggggcgtcc aggcgcagac       240
     ctggcggccg cccttcacga gggcacgctg gagcgcgaag cgtggcgggt ctgcgagaac       300
     ggcgcggaat atctggcgcg cctgacgatc accgcactgt tcgaaggcga cacacatcgc       360
     ggcttcgcct gcatcagccg cgatgtcacc gacgaggcgg cggtccgcgc atcgatcgag       420
     acccgcgagc agcatctgca atcgattctg gcgacggtgc cggatgcgat gatcatcatc       480
     gacgagaccg gcgccatcac gtcgttcagc gcagcggcac aacgcctgtt cggctacagc       540
     gaagccgagc tcgtcggccg caacgtctcc tgccttatgc cccagcccga tcgcgaccgt       600
     cacgacgaat atctcgcgca ttatctgcag accggcgagc gccggatcat cggcctcggt       660
     cgcgtcgtgg tcggccagcg ccgcgacggc tcaaccttcc cgatgcagct gtcggtcggc       720
     gaggccggtg aagacgggca gcggttgttc accggcttta tccgggatct caccgccaag       780
     gagcaggatg agctcaggct caaggaactg caggcagagc tggtccatgt ctctcggctg       840
     agcgcgatgg gcacgatggc ctcgacgctc gcgcatgagc tcaaccagcc gcttgccgcg       900
     gtcgcgctct atctcgagac gatccgcgac atgctcgacg agcgggacga cgaacccttc       960
     gtgtcgctac ggtcggtgat ggatgatgcg gcacaggaaa cgctgcgggc cggccatatc      1020
     gtccggcgcc tgcgcgattt cgtcgcccgc ggcgaggtcg acaagagcct ccacgagctg      1080
     ccgcaggtca tcgccgaggc gagccagctc gcgctggtcg gtgcacgcga gcgcggcatc      1140
     cgcagcttct ttgcggtcga tcccgccgcg acgccggtcc tcgtcgacag ggtgcagatc      1200
     cagcaggtgc tggtcaacct gatgcgcaat gccatcgagg cgatggcgga gtgtccggtt      1260
     cgcgacctca aggtggcgac caggttgcgc cctgacgggc tgatcgaggt gaccgtggag      1320
     gataccggtc ccggcatcgc ggacggaatc cgcgagcagc tcttcacggc gttcaactcg      1380
     acaaaggccg acggcatggg cctcggcctc tcgatctgcc ggaccatcat cgaagcgcat      1440
     ggcggccgta tctggatgga gcgccccgac cgcggcggca cccgctttca ttttaccttg      1500
     atccatgcgc gggcggagga ggaacatggg ggatag                                1536
//

If you have problems or comments...

PBIL Back to PBIL home page