(data stored in ACNUC7421 zone)

EMBL: AP010803.PE495

AP010803.PE495       Location/Qualifiers
FT   CDS_pept        500526..500933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04950"
FT                   /product="CheY-like response regulator"
FT                   /note="response regulator containing a CheY-like receiver
FT                   domain and an HTH DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04950"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95329"
FT                   /db_xref="GOA:D4YY97"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY97"
FT                   /protein_id="BAI95329.1"
FT                   /translation="MPSVRSTQHDGRYTILVSDDDPGVRRGLQLLLRSRGYAVWGYTTG
FT                   HALLADPRAKEADCVILDYRMPDIDGFAMLRHLREIGWSGRAIMISGFHDTLLASRAAE
FT                   AGFDHVLAKPLIGRALLDALDRHRAETLRKH"
     atgccatcgg tccgttccac ccagcatgat ggcagataca ccatcctcgt ttccgacgac        60
     gatcccggcg tgcggcgtgg cctccagctg ctgctgagat cgcgcggcta tgctgtgtgg       120
     ggatatacca ccggccacgc gctgttggcc gacccgcgcg cgaaggaagc agactgcgtc       180
     atcctcgact atcgcatgcc cgacatcgac ggattcgcga tgctgcgtca ccttcgcgag       240
     atcggatggt cgggacgcgc catcatgatc tcaggctttc acgacacgct gctggcctcg       300
     cgggccgccg aggcgggctt cgatcacgtt ctcgcaaagc ctttgatcgg cagggctttg       360
     ctcgatgcgt tggaccggca ccgcgccgag acgcttcgaa agcattga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page