(data stored in ACNUC7421 zone)

EMBL: AP010803.PE499

AP010803.PE499       Location/Qualifiers
FT   CDS_pept        505844..506632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04990"
FT                   /product="SDR-family protein"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04990"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95333"
FT                   /db_xref="GOA:D4YYA1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYA1"
FT                   /protein_id="BAI95333.1"
FT                   /translation="MKPLPIQNSWVLVTGASTGLGRASALRLAASYQAKPLIVGRRLDN
FT                   LRELQSEIGERFNVPCEIIVADQREIEGREKIAAKVIELKVNAAFLAAGLTSAGPFDAS
FT                   RADAYAEVIGTNVAGFTDLLARLIAIFRQQPFESSIIAVSSLAGETSVPFQAVYGASKA
FT                   YVSTLMRALSIELAGTGVSVGSFAPGGIDTDMAALSDLKWGKLGLMNVDRCATLAVDAL
FT                   VHRRSFAIPGMGNRLTYLASRALPRSLVSRLAALPYRRPQ"
     atgaaaccgc tgccgatcca gaactcgtgg gtgctggtta caggggcctc aaccggtttg        60
     ggcagggcgt cagccctccg tttggcggca tcgtaccagg ccaagcccct gattgttggg       120
     cgaaggctcg acaacttgcg ggagctacaa tccgaaattg gcgagcggtt taatgtcccg       180
     tgcgagatca tagtggccga tcaacgtgaa attgagggca gggagaagat tgcggccaag       240
     gttatagaat tgaaagtcaa tgcggctttc ttggctgccg ggctgacgag cgccggtccg       300
     tttgatgcta gccgtgccga cgcctatgcc gaggtgattg gaacaaacgt agccggcttc       360
     acggatttgc tggcccgcct gattgcgatc ttccggcagc agccgtttga atcctcaata       420
     atcgcagtgt cgagcctggc gggcgaaaca tccgtaccct tccaagcggt ctacggcgcg       480
     tcgaaggcct atgtgagtac cctcatgcgg gcactttcca tcgagcttgc cgggacgggt       540
     gtgagcgttg ggtcttttgc acccggtggc attgacaccg acatggctgc cctcagcgat       600
     ttgaagtggg gaaagttggg cttgatgaac gttgatcgct gcgcgaccct tgccgtcgac       660
     gctctggttc atcggcgatc cttcgccata ccggggatgg gcaaccgact cacatacttg       720
     gcgagcaggg ctctacctcg atcgttggtg agccggcttg cggcactccc atatcggcgc       780
     ccgcaatga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page