(data stored in ACNUC7421 zone)

EMBL: AP010803.PE50

AP010803.PE50        Location/Qualifiers
FT   CDS_pept        complement(51627..52124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00500"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00500"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94884"
FT                   /db_xref="GOA:D4YX02"
FT                   /db_xref="InterPro:IPR038750"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX02"
FT                   /protein_id="BAI94884.1"
FT                   /translation="MLHQGLAPRLGLSFGMTVNLVGAIVLLLWWPLRQRPGLGTVCNIA
FT                   VIGTAVDISLLILPTPEGHAMRFAWLAAGILLNGIAGGAYIGAGLGPGPRDGLMTGFCR
FT                   RTGLPVKWVRTGIEIGVLAAGWLLGGTVGLGTLLYAATIGWIVHHALPFFAIAARERPA
FT                   PA"
     gtgctgcatc aggggctggc gccgcgactg ggcctgagtt tcggcatgac ggtcaatctg        60
     gtcggggcga tcgtcctgct gctctggtgg ccgctgcgcc agcggcccgg cctcggcacc       120
     gtctgcaaca tagcggtgat cgggacggcg gtggacatca gcctcctgat cctgccgacg       180
     ccggagggcc atgccatgcg tttcgcctgg ctggcggcgg gaatcctcct caacggcata       240
     gcgggcggcg cctatatcgg cgcggggctg gggccggggc cgcgcgacgg gctgatgacg       300
     ggtttctgcc gccgcaccgg attgccggtc aaatgggtgc gcaccggcat cgagatcggc       360
     gtgctggcgg ccggctggct gctgggcggc acggtcggcc tcggcacttt gctctatgcg       420
     gcgacgatcg gctggatcgt gcaccatgcc ttgcccttct tcgccatagc cgcgcgcgaa       480
     cgtcccgcgc ctgcctga                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page