(data stored in ACNUC7421 zone)

EMBL: AP010803.PE500

AP010803.PE500       Location/Qualifiers
FT   CDS_pept        complement(507031..507777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05000"
FT                   /product="SDR-family protein"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05000"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95334"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYA2"
FT                   /protein_id="BAI95334.1"
FT                   /translation="MLPRATTTPMMAKDSMLEWLKSQIVRRNVTVKDDIAAVVARAQAR
FT                   RPVDILVNNAGGGVIGATEEMSDAEVEGQIALNLMAPIHITRAFVPAMRLRGSGRIIQI
FT                   SSASGQGSLPTSSLYHAAKWGLEGFSECLRQELEPFNLFVTLIEPGGARTSFSHNLQFA
FT                   SEIAAYRDTPAGDIRKMFETAGNELYTLDPQKIAQAIVDVATSDHPPLRVTLGGDAFGV
FT                   VQAALQSRLAFLQSQEALARSVAFDS"
     atgctgccga gagcgacgac gacgcccatg atggcaaaag attccatgct cgaatggctc        60
     aaaagccaga tcgtgagaag gaacgtcacg gtcaaggacg atattgctgc ggtcgtggcc       120
     cgggcgcagg cgcgtcgacc cgtcgatatt ctggtcaaca acgccggcgg cggcgtgatc       180
     ggcgccaccg aagagatgtc ggacgccgag gtcgaaggcc agatcgcgct caatctcatg       240
     gcgcccatcc acatcacccg cgcctttgtc cccgcgatgc gcctgcgcgg gagcggccgg       300
     atcatccaga tctccagcgc cagcggtcag ggctcgcttc cgacgagcag tctctatcat       360
     gcggccaaat ggggcctgga gggcttcagc gaatgcctcc gccaggagct tgaacccttc       420
     aacctgttcg tgacgctgat cgagccgggt ggcgcgcgca ccagcttcag ccacaacctg       480
     caattcgcca gcgagatcgc cgcctatcgc gatacgcccg ccggcgatat ccgcaagatg       540
     ttcgagaccg ccggaaacga gctctacacg ctcgacccgc aaaagatcgc gcaagcgatc       600
     gtcgatgtcg caaccagcga ccatccgccg ctgcgcgtga ctctgggggg tgacgctttc       660
     ggcgttgtcc aggcggcgct gcaatcgcgg ctcgcctttc tgcagtccca ggaagcgctc       720
     gcgcgctcgg tcgctttcga cagttga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page