(data stored in ACNUC7421 zone)

EMBL: AP010803.PE503

AP010803.PE503       Location/Qualifiers
FT   CDS_pept        complement(509014..509451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05030"
FT                   /product="putative metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05030"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95337"
FT                   /db_xref="InterPro:IPR007332"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYA5"
FT                   /protein_id="BAI95337.1"
FT                   /translation="MKTRLFVALLFLAMPGVALAASDIVVHRDPGCGCCEKWAQAVRAK
FT                   LGRKVVMRDDASRSELQRKAGMPRTLASCHSAIVDGYMIEGHVPISDVKRLLATRPAGV
FT                   KGIAVAGMPIGSEGMEVAGAARQPYTVVAFGSAGQRIFARH"
     atgaagaccc gcctattcgt cgccttgctg ttcctcgcca tgcccggcgt agcgcttgcg        60
     gccagtgata tcgtcgtcca ccgggatccg ggatgtggat gttgcgagaa gtgggcgcag       120
     gccgtgcgcg cgaagctggg acgcaaggtc gtcatgcgtg acgatgcgtc gcgcagcgag       180
     cttcagcgca aggccggcat gccccggacg ctggcatctt gccacagcgc gatcgtcgat       240
     ggctatatga tcgagggcca tgtcccgata tccgacgtca agcgcttgct ggcgacccgt       300
     cctgcgggcg tcaaaggcat tgcggttgcg gggatgccga tcggttcgga gggcatggaa       360
     gtggcaggcg ctgcccgcca accctatacg gtggtggcct tcggcagcgc cggtcagcga       420
     attttcgccc gccattga                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page