(data stored in ACNUC7421 zone)

EMBL: AP010803.PE505

AP010803.PE505       Location/Qualifiers
FT   CDS_pept        complement(510766..511752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copB"
FT                   /locus_tag="SJA_C1-05050"
FT                   /product="copper resistance protein CopB"
FT                   /note="uncharacterized protein involved in copper
FT                   resistance"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05050"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95339"
FT                   /db_xref="GOA:D4YYA7"
FT                   /db_xref="InterPro:IPR007939"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYA7"
FT                   /protein_id="BAI95339.1"
FT                   /translation="MIRIFPSRGIALGAALFLAPAITAPALAQDASPPSPAATPAQTAT
FT                   PAQHTPSAQGSQDHAGMDMPGMDMTDTKASGNGATMDMGSMQGGKAPPDARNSDDYADG
FT                   YRNSTLPGYEMADKLSIPKILVDELEFTSGNEGQGVGWTVLVTKGQDNDKLWLRSQGLK
FT                   NSRDQRLDPESSVEALWWHSKNPFWGTLLGVRQDLGKGATTWLAAGVEGLAPYWFDVQL
FT                   TGYVGTDGRLAARAKASYEVLFTNRLILTPQVETNIYSKRSSDRQLGSGFSNVELSGRL
FT                   RYEVSRKFAPYIGFVWERAFDGTADFRRLRREGPSEHRLVIGLRAWW"
     atgatccgga ttttcccctc gcgcggcatc gctcttggcg ctgccctctt cctggcgccg        60
     gcgatcacgg ctcccgccct cgcgcaggat gcctcgcccc cgtcgcccgc cgccacccct       120
     gcccaaacgg ccactcccgc tcagcacacc ccttccgcgc aaggctctca ggaccatgcg       180
     ggcatggaca tgccgggcat ggatatgacc gacacgaagg cgtccggtaa cggcgccacg       240
     atggacatgg gctcgatgca gggtggcaag gccccgccgg acgcgcgcaa ctcggacgat       300
     tatgccgacg gctatcgcaa ctcgacgctg ccgggctatg agatggccga caagctctcg       360
     atccccaaga tacttgtgga tgagctcgag ttcaccagcg gcaacgaggg tcagggcgtg       420
     ggctggaccg tgctcgtcac caagggtcag gacaatgaca agctctggct gcgcagccag       480
     gggctcaaga actcccgcga ccaacgtctc gatccggaga gcagcgtcga ggcgctgtgg       540
     tggcacagca agaacccgtt ctggggcacg ctgctcgggg tcaggcagga tctcggcaag       600
     ggtgcgacca cctggctcgc cgccggcgtc gagggactgg cgccctattg gttcgacgtc       660
     cagctcaccg gctatgtagg aaccgatggg cgtctcgcgg cgcgcgccaa ggcctcctat       720
     gaggtcctgt tcaccaatcg gttgatcctt acgccgcagg tggaaaccaa tatctattcg       780
     aagcggtcga gcgatcggca gctcggcagc ggcttcagca atgtcgagct gagcggacgg       840
     ttgcgctacg aggtgtcgcg caagttcgcg ccctatatcg gcttcgtctg ggagcgcgca       900
     tttgacggca cggccgattt ccgtcgcctg cgcagggaag ggccttccga acacaggctg       960
     gtgatcggct tgcgcgcctg gtggtga                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page