(data stored in ACNUC7421 zone)

EMBL: AP010803.PE506

AP010803.PE506       Location/Qualifiers
FT   CDS_pept        complement(511749..513455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copA"
FT                   /locus_tag="SJA_C1-05060"
FT                   /product="copper resistance protein CopA"
FT                   /note="putative multicopper oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05060"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95340"
FT                   /db_xref="GOA:D4YYA8"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006376"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="InterPro:IPR034279"
FT                   /db_xref="InterPro:IPR034282"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYA8"
FT                   /protein_id="BAI95340.1"
FT                   /translation="MSPLHIRPIARRRFVQGLAIGGAVAGFAPALLARSAPVSPAELSG
FT                   TEFDLEIAELPVNFTGKRRIATAVNGSVPAPVLRLREGDTVTLRVRNGLKEMSSIHWHG
FT                   IIVPAEMDGVPGISFAGIAPGETFTYRFEVRQSGTYWYHAHTLAEQTGLYGAIIVEPKQ
FT                   VPTARAPDRDYCIVLSDWSDEPPLQIFLNLKKQSSYYNFAQPTAGDFLKDVGTMGLGKA
FT                   LERRRMWNSSRMNPTDYSDVSAATYTYLMNGAPPAGNWTGIAAPGERVRLRFVGAGTAT
FT                   FFDVRIPGVELTVVSTDGQPVEPVTVEEFRIGPGETYDVEFTMPEGGARTIFAQAIDRS
FT                   GYARGTIAPAPGMAAAVPLLDARTWLEPVDMMGAMATMGAMGGDAHAGHGMTEMPARAR
FT                   HARTEYGANTDMRVDYPRTNLDDPGAGLRGRGWRVLTLADLRTPGGDPDPREPERDIEL
FT                   HLTGNMERFIWSLDGIKLNDSRPLHFKPNERLRVTFVNDTMMAHPMHLHGMWSDVEGPD
FT                   GAFQVRKHTVVVQPAQRVSFRVTADAMGRWAFHCHLLYHMAAGMFREVVVA"
     atgtctccct tacatatccg gccgatcgcg cggcgccgtt tcgtccaggg gctggcgatc        60
     ggcggcgcgg ttgccggctt cgccccggcg cttctcgcgc gatccgcccc agtctcgccc       120
     gccgagctta gcgggaccga gttcgacctc gagatcgccg agctgccagt caacttcacc       180
     ggcaaacgcc gtatcgcgac cgccgtgaac ggcagcgtgc ccgcgccggt cctgcgcctg       240
     cgcgaaggcg acacggtcac gctccgtgtg cgcaacggcc tcaaggagat gtcgagcatc       300
     cattggcacg gcatcatcgt gccggcggag atggacggcg tgcccggcat cagctttgcc       360
     ggcatcgcgc cgggcgagac cttcacctat cgcttcgagg tccgccagag cggaacctac       420
     tggtatcacg ctcacacgct cgccgagcag acgggactct atggagcgat catcgtggag       480
     ccaaaacagg tgccgacggc gcgggcgccc gatcgcgact attgcatcgt gctcagcgac       540
     tggtcggacg agccgccgct gcagatcttc ctcaatctca agaagcagag cagctactat       600
     aattttgcgc agccgaccgc cggcgatttc ctcaaggatg tcggcaccat gggcttgggc       660
     aaggcgctcg agcggcggcg gatgtggaac agctcgcgga tgaacccgac cgactacagc       720
     gatgtctctg ccgcgaccta cacctatctg atgaacggcg cgccgcccgc cggcaactgg       780
     accggtatcg ccgcgcccgg cgagcgcgtg cgcctgcgct tcgtcggcgc ggggacggcg       840
     acgttcttcg acgtgcggat ccccggggtc gagctgacgg tcgtatcgac cgacgggcag       900
     ccggtcgagc cggtcacggt cgaggaattc cggatcggcc cgggcgagac ctacgacgtc       960
     gagttcacca tgcccgaggg cggcgcccgc accatcttcg cgcaggcgat cgatcggagc      1020
     ggctatgcgc gtggcacgat cgcaccggcc ccgggcatgg cggcagccgt gccgctgctc      1080
     gatgcccgga cctggctcga gccggtcgac atgatgggcg cgatggcgac gatgggcgca      1140
     atgggaggcg acgcgcatgc cgggcacggc atgaccgaga tgccggccag ggcacggcac      1200
     gcccgcaccg aatatggcgc caataccgac atgcgcgtcg actatccgcg caccaatctc      1260
     gacgatcccg gcgccgggct gcgcgggcgc ggctggcgcg tgctgacgct ggccgatctg      1320
     cgcacgccgg gcggcgatcc cgacccgcgc gagcccgagc gcgacatcga gctgcatctg      1380
     acgggcaata tggaacggtt catctggtcg ctcgacggca tcaagctcaa cgattccagg      1440
     ccgcttcatt tcaagccaaa cgagcggctg cgcgtcacct tcgtcaacga cacgatgatg      1500
     gcgcatccga tgcatctgca cggcatgtgg agcgatgtcg aaggcccgga cggcgccttc      1560
     caggtccgca agcatacggt cgtggtccag cccgcccagc gggtgagctt ccgcgtcacc      1620
     gccgacgcca tgggccgatg ggccttccac tgccatctgc tctatcacat ggcggccggc      1680
     atgttccggg aggtggtggt cgcatga                                          1707
//

If you have problems or comments...

PBIL Back to PBIL home page