(data stored in ACNUC7421 zone)

EMBL: AP010803.PE51

AP010803.PE51        Location/Qualifiers
FT   CDS_pept        complement(52128..52244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00510"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94885"
FT                   /db_xref="GOA:D4YX03"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX03"
FT                   /protein_id="BAI94885.1"
FT                   /translation="MISAAMLMHRRLFQLFWGLGLYGFSMALMLRADLGLDP"
     gtgatttcag ccgccatgtt gatgcaccgc cgtcttttcc agcttttctg gggacttggc        60
     ctctatggct tctccatggc cctgatgctg cgcgccgatc tggggctgga cccctag          117
//

If you have problems or comments...

PBIL Back to PBIL home page