(data stored in ACNUC7421 zone)

EMBL: AP010803.PE513

AP010803.PE513       Location/Qualifiers
FT   CDS_pept        complement(518107..518550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05130"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05130"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95347"
FT                   /db_xref="GOA:D4YYB5"
FT                   /db_xref="InterPro:IPR012427"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYB5"
FT                   /protein_id="BAI95347.1"
FT                   /translation="MITIEADWLSAFFRLAVIGLELAGTLTILVGAGLATFLFARRARA
FT                   GDRTEAYSTFRSALGRSILLGLEFLVAGDIVKSLVINPTLDDLIVLAGLVLVRTFLSIS
FT                   LGVEINGHWPWEETRMAREKARAASDGSPATAEAAGCGTPRKG"
     atgatcacca ttgaggccga ctggctgagc gccttcttcc ggctcgccgt gatcggcctg        60
     gaactggcgg gcacgctgac catcctggtc ggcgcggggc tcgcaacctt tctgtttgcg       120
     cggcgggcga gggcgggcga ccgaaccgag gcctatagca cgttccgctc ggcgctcggc       180
     cgcagcatcc tgctcggcct ggaatttctg gtcgccggcg acatcgtcaa gtcgctggtg       240
     atcaacccga cgctcgacga tctcatcgtg ctggccgggc ttgtgctggt gcggaccttc       300
     ctgagcatct cgctcggggt cgagatcaac ggtcactggc cctgggagga aacccggatg       360
     gcgcgggaga aggcgcgtgc ggcgtcggat gggtcgccgg cgacggctga ggccgccgga       420
     tgcggcacac cgcgcaaggg atag                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page