(data stored in ACNUC7421 zone)

EMBL: AP010803.PE514

AP010803.PE514       Location/Qualifiers
FT   CDS_pept        complement(518537..519259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05140"
FT                   /product="cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05140"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95348"
FT                   /db_xref="GOA:D4YYB6"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYB6"
FT                   /protein_id="BAI95348.1"
FT                   /translation="MSWQRLSYAVFIAALLVMVAAVAIRMRSDAPRDAGLVAQLVSPGP
FT                   LSSAHQSFAGQCTACHTPGKGVETRTCLTCHAGTDFGTKQSTQFHAKATQCTSCHVEHE
FT                   GERGIIRMDHAALLDMAKWRQPLAGMSTNTRSLTPETALNCASCHAFRDPHQGLFGTDC
FT                   ASCHKTDSWKIANYRHPSVNSTQCAECHKAPPSHFMEHFSMVSQRAAGSKARVDQCYAC
FT                   HATDSFNNIRKRGWYDHH"
     atgagctggc agcgtctttc ctacgccgtc ttcatcgcag ccctgctggt gatggtcgcc        60
     gcggtcgcga tccggatgcg atcggacgcg ccgagggatg ccggcctggt ggcgcagctc       120
     gtctcgcccg gcccgctctc gagcgcgcac cagtcctttg ccggccaatg cacggcctgc       180
     cacacgccgg gcaagggcgt cgaaacccgg acctgtctca cctgccatgc gggcaccgat       240
     ttcgggacga agcagtcgac gcagttccac gcgaaagcga cgcagtgcac ctcctgccac       300
     gtcgaacatg agggagagcg cggcatcatc cgcatggatc acgccgcgtt gctcgacatg       360
     gcgaagtggc ggcagccttt ggcgggcatg tcgacaaaca ctcgaagcct gacccccgag       420
     accgcgctca attgcgcgag ctgccatgcg ttccgcgatc cgcaccaggg cctgttcggc       480
     accgactgcg cgagctgcca caagaccgac agctggaaga tcgccaatta ccgccatcca       540
     tcggtcaatt cgacgcagtg cgccgagtgc cataaggcgc cgcccagtca cttcatggag       600
     catttcagca tggtctcgca gcgcgcagcc ggatcgaagg cgcgcgtcga ccaatgctat       660
     gcctgtcacg ccaccgacag cttcaacaat atccgcaagc gaggctggta tgatcaccat       720
     tga                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page