(data stored in ACNUC7421 zone)

EMBL: AP010803.PE515

AP010803.PE515       Location/Qualifiers
FT   CDS_pept        complement(519256..519984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05150"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05150"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95349"
FT                   /db_xref="GOA:D4YYB7"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYB7"
FT                   /protein_id="BAI95349.1"
FT                   /translation="MRERSDIAVGLLVAFLLLFPFGYLVHVSPRFPGSLAGGIIGIAAL
FT                   VLMLLTLPYVAAKHIAWVDKALSRVVSKPTLLAIHIYAGVLAPILGLVHAAHKLESPVG
FT                   LLLTVLLLMTVITGFIGRYLLAQLGRALRGRRSELASLRAAFLEEPAAPTQADTAAPPL
FT                   SGWKRYLFVAGDASAGQRPQDKAGIAAALADTEFAIRAEEATNTLFARWRFLHILLGCL
FT                   IFALLALHVGAAIYYGLRWL"
     atgcgcgaac gcagcgacat tgccgtgggc ctgctggtcg cgttcctgct gctgttcccg        60
     ttcggctatc tcgtgcatgt gtcgccccgc tttccgggta gcctggccgg cgggatcatc       120
     gggatcgcag cgctcgtgct gatgctgctg acgcttcctt atgtcgcggc caagcacatc       180
     gcctgggtcg acaaggcgct ctcccgggtc gtcagcaagc caaccctgct cgccatccac       240
     atctatgccg gcgtgctggc gccgatcctg ggtctggtcc acgccgcgca caagctcgaa       300
     agcccggtcg gcctgcttct gaccgtcctc ctgctgatga cggtcatcac cggcttcatc       360
     ggccgctacc tgcttgccca gcttggtcgg gcgctgcgcg gacgcaggtc agaactggcc       420
     tcgcttcgcg ccgccttcct cgaggagccg gcggcgccga cgcaggccga taccgcagcc       480
     ccgccgctgt cgggctggaa gcgctatctg ttcgtcgccg gggatgcgtc cgcgggccag       540
     cgcccccagg acaaggcggg gatcgccgca gcgctggccg ataccgaatt cgcgatccgt       600
     gccgaagagg caaccaacac cctgttcgcg cggtggcggt tcctgcacat cctgctgggc       660
     tgtctcatct tcgcgctgct cgcgctccac gtcggcgcgg cgatctatta cgggctgcgc       720
     tggctatga                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page