(data stored in ACNUC7421 zone)

EMBL: AP010803.PE517

AP010803.PE517       Location/Qualifiers
FT   CDS_pept        complement(521918..522238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05170"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95351"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYB9"
FT                   /protein_id="BAI95351.1"
FT                   /translation="MIDHAKKALPLVGGSLLLALALSGCDRQADQTVPPAANSVAATPV
FT                   LTDSGNAADAAPMDAMSNQAEMERHHRQAMDHDAMRAGAGNQTAPAPDPAPGNAAMPMK
FT                   DM"
     atgatcgacc atgcgaagaa agcccttcca cttgtcggcg gaagcctgtt gctggcgctc        60
     gcgctttcgg gctgcgaccg ccaggccgac cagacggtgc cgcccgcggc gaacagcgtc       120
     gccgccaccc cggtcctgac cgacagcggc aacgctgcag acgcggcgcc gatggacgcg       180
     atgagcaacc aggccgagat ggagcggcat caccgtcagg cgatggacca tgacgcgatg       240
     cgcgccgggg ccggcaacca gaccgcgccg gcacccgatc ccgcgccggg caatgcggcg       300
     atgccgatga aggatatgta g                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page