(data stored in ACNUC7421 zone)

EMBL: AP010803.PE518

AP010803.PE518       Location/Qualifiers
FT   CDS_pept        complement(522298..522519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05180"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95352"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYC0"
FT                   /protein_id="BAI95352.1"
FT                   /translation="MKKMRLIAVLTPALLLGACVTTRPTSAQVESCRAMEGNMGLQTPH
FT                   DHGEMKGQGRNPMNLSHDRCLRILRSAQ"
     atgaagaaaa tgcgtttgat cgccgtcctc acgccggcgc tgcttctagg cgcctgtgtg        60
     accacgcggc cgacctcggc gcaggtcgag agttgccggg cgatggaggg caatatgggt       120
     ctccagacgc cgcatgatca tggcgagatg aaggggcagg ggcgcaaccc gatgaacctc       180
     tcgcacgacc ggtgtctccg gattctgcgc agcgcgcaat ga                          222
//

If you have problems or comments...

PBIL Back to PBIL home page