(data stored in ACNUC7421 zone)

EMBL: AP010803.PE52

AP010803.PE52        Location/Qualifiers
FT   CDS_pept        52319..53782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00520"
FT                   /product="GntR-family transcriptional regulator"
FT                   /note="aminotransferase / transcriptional regulator
FT                   containing a DNA-binding HTH domain and an aminotransferase
FT                   domain (MocR family)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00520"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94886"
FT                   /db_xref="GOA:D4YX04"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX04"
FT                   /protein_id="BAI94886.1"
FT                   /translation="MSTSLLRPPSLLRLLGAWRAEDSAEPAYRQLAQALRMLVLDGRVG
FT                   LNVRLPGERELAAALGLSRTTIAAAFDRLRDEGFLESRQGSGSVTRLPPGRMDQALPEI
FT                   DTIGGGNILNWTHAALPAAPGVGRAYQAAVEALPAFLGELGYDPLGLPPLRRAIAAYYE
FT                   RRGCPTSPDQIIVTNGAQQGFSLLLHWLAGPGDRAVIDHPTYHNAIQALQRAHVVPVPV
FT                   GLPAQGWDIDAMEAAFRQTSPRFAYIIADFHNPTGRSMDPGTRRALVAAATRSHMPLII
FT                   DETMAAMGLDNMPPPPVAVHDPSGRQVITLGSASKIFWGGLRVGWIRADPQTVAALGRL
FT                   RTTMDMASPVVEQLAVAHLIDGDEGLGPRAAMLRGRRDHLLALIERHLPHWRAESPAGG
FT                   LSLWAELPRGEATALAAIAESHGVRVAPGPRFGVSGAFERFLRLPFTLSEEQLTAGVER
FT                   LAEADARLHARLPRARDSVAAALEADRLI"
     atgtccactt ccctcctgcg gcccccttcc ctgcttcgcc tgctgggcgc ctggcgcgcc        60
     gaggacagcg ccgaacccgc ctatcgccaa ctggcgcagg cgttgcggat gctggtgctg       120
     gacgggcgcg tgggattgaa cgtccgcctg ccgggggaaa gggaactggc ggccgcgctg       180
     ggcctcagcc gcacgaccat cgccgccgcc ttcgaccggc tgcgcgacga aggcttccta       240
     gaaagccggc aggggtcggg cagcgtcacc cgcctgccgc ccggccggat ggaccaggcc       300
     ctgccggaaa tcgacacgat cggcggcggc aacatcctga actggaccca tgccgccttg       360
     cccgccgcgc cgggcgtggg ccgcgcctat caggcggcgg tggaggcgct gcccgccttt       420
     ctgggcgagc tgggttacga tccgctgggc ctgccgccgc tgcgccgggc gatcgcggcc       480
     tattatgaac ggcggggatg ccccaccagt cccgaccaga tcatcgtcac caacggcgcc       540
     cagcagggat tttcgctgct gctgcactgg ctggcggggc cgggcgaccg ggcggtgatc       600
     gaccatccca cctatcataa tgcgatccag gccctgcagc gcgcccatgt cgtgccggtg       660
     cctgtcggcc tgcccgcgca ggggtgggac atcgacgcga tggaggcggc cttccgccag       720
     accagcccgc gtttcgctta tatcatcgcg gatttccaca atcccaccgg acgcagcatg       780
     gaccccggca cccgccgcgc gctggtggcg gcggcgacgc gcagccatat gccgctgatc       840
     atcgacgaga ccatggccgc gatgggcctg gacaacatgc cgccgccgcc ggtcgccgtg       900
     cacgatcctt ccgggcggca ggtcatcacc ctgggttcgg ccagcaagat cttctggggc       960
     gggctgcgcg tcggctggat tcgcgccgac ccgcagaccg tcgccgcgct gggccgcctg      1020
     cgcacgacga tggacatggc cagcccggtg gtggagcagc ttgccgtcgc tcatctgatc      1080
     gacggcgatg aagggcttgg cccgcgcgcg gcgatgctgc gggggcgccg ggaccatctg      1140
     ctggcgctga tcgaacggca cctgccgcac tggcgcgccg aatccccggc ggggggcctg      1200
     tcgctatggg cggagctgcc gcggggcgag gcgacggcgc tggccgccat cgcggagagc      1260
     cacggcgtgc gcgtggcccc ggggccgcgc tttggcgtga gcggcgcgtt cgagcgcttc      1320
     ctgcgcctgc ccttcaccct gtcggaggag cagttgacgg cgggcgtgga acggctggcc      1380
     gaagccgatg cgcggctgca cgcccgcctg ccccgcgccc gcgattcggt tgccgccgcg      1440
     ctggaggcgg accggctgat ctga                                             1464
//

If you have problems or comments...

PBIL Back to PBIL home page