(data stored in ACNUC7421 zone)

EMBL: AP010803.PE520

AP010803.PE520       Location/Qualifiers
FT   CDS_pept        complement(523136..523492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05200"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95354"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYC2"
FT                   /protein_id="BAI95354.1"
FT                   /translation="MVRKTLMVALAGISMLAAVPAMAQGIGHSLFMRGSIVDTGSNGTV
FT                   VCIGKADGAEVGQKLEVYRVVTHPGPSKGVAPTYHRQLVGHVTIDHIFDDHFAHVSVAD
FT                   GTPARHDIVELRKN"
     atggtcagaa aaactctcat ggtcgcgctt gccggcattt cgatgcttgc tgccgtcccc        60
     gctatggccc agggcatcgg gcacagcctg ttcatgcgcg gctcgatcgt cgacacgggc       120
     agcaacggca cggtcgtctg catcggcaag gccgatggcg ccgaggtcgg ccagaagctc       180
     gaggtctatc gcgtcgtgac ccatccgggt ccgtccaagg gcgtggcgcc gacctatcac       240
     cgccagctcg tcggccatgt gacgatcgac catatctttg acgatcactt cgcgcacgtg       300
     tccgtcgccg acggcacgcc tgccaggcac gacatcgtcg agcttcgcaa gaactga          357
//

If you have problems or comments...

PBIL Back to PBIL home page