(data stored in ACNUC7421 zone)

EMBL: AP010803.PE521

AP010803.PE521       Location/Qualifiers
FT   CDS_pept        523736..524098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05210"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95355"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYC3"
FT                   /protein_id="BAI95355.1"
FT                   /translation="MKRLLALLLVIGALSGLFGAQMAAAHSVPQAAGAPLAKGMDADCM
FT                   AMMAKQQPAPSEKPCKGLTLDCIAAMGCVIPLVAADLAGGVAPARLYDAPSFWTTDTIL
FT                   TGKAVAPEPDPPTSLA"
     gtgaaacgcc tgctcgccct cctgctcgtc atcggagcgc tgtccggtct cttcggagcc        60
     cagatggcgg ccgcgcacag cgtgccgcag gcggcaggcg cgccgctggc caagggcatg       120
     gatgcggact gcatggcgat gatggccaag cagcagcctg cgcccagcga aaagccctgc       180
     aagggcctga cgctcgattg catcgccgcg atggggtgcg tgatcccgct ggtcgcagcg       240
     gacctggcag gcggcgttgc gcctgcgcgt ctctacgacg cgcccagctt ctggacgacc       300
     gacacgatat tgaccggcaa ggcggttgcg cccgagccgg atcctcccac cagccttgcc       360
     tga                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page