(data stored in ACNUC7421 zone)

EMBL: AP010803.PE522

AP010803.PE522       Location/Qualifiers
FT   CDS_pept        524176..524433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05220"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95356"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYC4"
FT                   /protein_id="BAI95356.1"
FT                   /translation="MIKLLPAALVAALSLAAPALATDASRTPQGHWEWRSAPQYGPRAT
FT                   GPARVRIWVPDSRDMASCDCAMMQASAADCMRGAVRSDKG"
     atgatcaaac tgcttccggc cgcccttgtg gcggccctca gtctcgccgc gcctgcgctt        60
     gcaaccgacg cgagccgcac gccgcaaggc cattgggaat ggcggtcggc gccgcaatat       120
     ggtccgcggg cgactggccc tgcgcgtgtc cgcatatggg tgcccgacag ccgggacatg       180
     gccagctgcg attgcgcgat gatgcaggca agcgccgccg actgcatgcg cggcgcagtc       240
     aggtcggaca agggctaa                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page