(data stored in ACNUC7421 zone)

EMBL: AP010803.PE53

AP010803.PE53        Location/Qualifiers
FT   CDS_pept        complement(53832..54089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00530"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94887"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX05"
FT                   /protein_id="BAI94887.1"
FT                   /translation="MQRPSGRRGRLRTGKRHAPANRRVVRRSRRPDLAARTWSGVARPA
FT                   DAGGKRTLPLFVTPDLIRGPAALDEAGAQTRKRDPGSSPG"
     atgcaaagac cgtcgggccg acgcggacgc cttcgcacgg gtaagcggca tgctcccgcg        60
     aacaggcggg tggttcgtag gtcccgccgc ccggacctcg cggcgcggac atggtcaggg       120
     gtcgcccgac cggctgatgc gggtggaaag cggacgctcc ccctattcgt caccccggac       180
     ttgatccggg gtcccgctgc cttggacgag gcgggcgctc agacaagaaa gcgggacccc       240
     ggatcaagtc cggggtga                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page