(data stored in SCRATCH zone)

EMBL: AP010803.PE533

AP010803.PE533       Location/Qualifiers
FT   CDS_pept        complement(540003..540611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05330"
FT                   /product="CDF-family cation efflux system protein"
FT                   /note="Co/Zn/Cd efflux system component / putative integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05330"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95367"
FT                   /db_xref="GOA:D4YYD5"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYD5"
FT                   /protein_id="BAI95367.1"
FT                   /translation="MIPGNDNNGGQERRTLWIVLLLNAAIAAGFFVSGFFADSSALIAN
FT                   GVDNLSDTAVYALSLVALTRGQTWKTRAAVASGVMLLIFAGGILIDVGRRYVQGSEPIG
FT                   PTMMVMSAIAGVVNYLCLRLLQRLKDPDVNLRAATTFSFNDFISNGGILIAGVLVLWLG
FT                   TNWPDLLVGFATAIIAIKGGVEILRDARAETKKSERRSS"
     atgatcccgg gcaacgacaa caatggcggg caggagcgcc gcacactgtg gatcgtcctg        60
     ctgctgaacg cggcgatcgc tgcgggcttc ttcgtttccg gcttcttcgc ggactcgagc       120
     gcgctgatcg ccaacggcgt cgacaacctg tccgatacgg ctgtgtatgc gctgagcctt       180
     gtggcgctca cccggggcca gacatggaag acacgcgccg cggtcgcttc gggcgtcatg       240
     ctgctgatct tcgcgggcgg catcttgatc gatgtcggac ggcgctacgt gcagggcagc       300
     gagcccatcg gacctaccat gatggtcatg tccgcgatcg ccggcgtcgt gaattacctc       360
     tgcctgcggc tgctccagcg cctcaaggat ccggacgtca atctccgggc cgcaaccacc       420
     ttcagcttca acgacttcat ttccaacggc ggcatcctga tcgccggcgt gctggtgctg       480
     tggttgggta ccaattggcc ggacctgctg gtcggcttcg ccaccgccat catcgccatc       540
     aagggcggtg tcgaaatcct gcgcgacgcg cgcgccgaaa ccaagaaaag cgaaaggagg       600
     tcgtcatga                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page