(data stored in SCRATCH zone)

EMBL: AP010803.PE535

AP010803.PE535       Location/Qualifiers
FT   CDS_pept        complement(541298..541711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05350"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95369"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYD7"
FT                   /protein_id="BAI95369.1"
FT                   /translation="MSDTSISNVTTLCGLNRAGLAIARLGVVLVSGAVIGACNPAPTQP
FT                   TEPAHEKHLTSKLIAQRIMYCDDGTRADVDFIDDGLKMAVTWLPKGRTEILRAQRTGDE
FT                   FRGDHSRAVVAGGSIAFTRRGKIRVCHRTPEES"
     atgtctgaca cgtcgatttc aaatgtgaca accttgtgcg gcctgaatcg ggccggtctg        60
     gcgatcgcgc gcctcggcgt cgttctcgtc tccggggcgg ttataggggc gtgtaatcca       120
     gcgccgaccc agcctaccga gccggcgcat gaaaagcatc tgacgtcgaa actaatcgcg       180
     cagcgcatca tgtactgcga cgacggcaca cgcgccgatg tcgacttcat cgatgacggc       240
     ttgaaaatgg ccgtcacctg gctgccgaag ggcaggaccg agatcctgcg cgcgcagcga       300
     accggtgacg agtttcgcgg cgaccattcg cgggctgtcg tggcgggcgg atcgatcgcg       360
     ttcacgcgac gcgggaagat ccgcgtctgc caccgaaccc cggaggagtc ctag             414
//

If you have problems or comments...

PBIL Back to PBIL home page