(data stored in ACNUC7421 zone)

EMBL: AP010803.PE536

AP010803.PE536       Location/Qualifiers
FT   CDS_pept        complement(541759..542136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05360"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95370"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYD8"
FT                   /protein_id="BAI95370.1"
FT                   /translation="MMMHCKRVLPAVILVVGLAACSERKPPAPPTEQQIHSSDSAVATG
FT                   EMGRHRYRCSDGEPLFVDYKDNGLQIDLRRSNGGPPMMLTAPAQGLQYVGETATATFKG
FT                   SQLTIVEGDGRTRICEQEGTR"
     atgatgatgc actgtaagcg ggtgctgccc gccgtcatcc tcgttgtcgg gctcgcggcg        60
     tgctcggaaa gaaagccgcc agccccgcca acggagcagc agatccattc gtccgacagc       120
     gccgtggcga ccggggaaat ggggcggcat agatatcgct gttccgacgg ggaaccgctg       180
     ttcgtcgatt acaaggacaa cggcctgcag atcgatttgc ggcgctccaa cgggggaccg       240
     ccgatgatgc tgaccgcgcc agcgcagggc ctgcaatatg tcggcgaaac agccaccgcg       300
     accttcaagg ggtcgcagct caccatcgtg gaaggcgatg gccgtacccg gatctgcgag       360
     caggaaggca cgcgatga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page