(data stored in ACNUC7421 zone)

EMBL: AP010803.PE537

AP010803.PE537       Location/Qualifiers
FT   CDS_pept        complement(542133..542597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05370"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95371"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYD9"
FT                   /protein_id="BAI95371.1"
FT                   /translation="MLHGGPLRIWSALTDPDHRRAWSPLVFLDDPSRLGDTECTFAIQG
FT                   ITRPIRTPARIDRFDKPHAFAWSCGIPYLFTLEERYELAGDDGGTRLTHSCTLRGALSL
FT                   PFAAMMLRRLRSLMVESDDRLATYLRWRVGQPARAINRQRVPFRCRRKAR"
     atgcttcacg gcgggccact gcgcatctgg tcggcactca ccgatccgga tcatcgccgg        60
     gcgtggagtc cgctcgtatt tctcgatgat ccgtcccggc tcggcgacac agaatgcacc       120
     tttgcgatcc agggcatcac ccggccaatt cggacgccag cacggattga tcgattcgat       180
     aaaccgcacg ccttcgcttg gtcctgcggc atcccctatc tgttcacgct cgaagagcgg       240
     tacgagctgg cgggggacga tggcggcacc aggctaacgc atagctgcac gctgcgcggg       300
     gcgctctccc tgccgttcgc ggcgatgatg ttgcgccgcc tgcgatccct gatggtcgaa       360
     tctgacgatc gcctcgcaac ctatctccgc tggcgggtag gtcagcctgc ccgggctatc       420
     aatcgtcagc gcgtcccctt ccgctgcagg aggaaggcgc gatga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page