(data stored in ACNUC7421 zone)

EMBL: AP010803.PE538

AP010803.PE538       Location/Qualifiers
FT   CDS_pept        complement(542675..545920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusA"
FT                   /gene_synonym="czcA"
FT                   /locus_tag="SJA_C1-05380"
FT                   /product="copper/silver efflux system membrane protein
FT                   CusA/CzcA"
FT                   /note="copper efflux system membrane protein CusA /
FT                   putative silver efflux pump, CzcA"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05380"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95372"
FT                   /db_xref="GOA:D4YYE0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYE0"
FT                   /protein_id="BAI95372.1"
FT                   /translation="MIARIVTWAVEKRWLVLLLTVIVAAIGAFSLYRLPIDAVPDITNN
FT                   QVQINVRAPALSPELVEKQVSFPIETALAGTPGLEYTRSLSRNGFAQITAVFSDATDIY
FT                   FARQQVGERLRGVQENLPDGVNPEMGPIATGLGEVYMYTVRLDHREDDKHKPGEPGQQP
FT                   DGSYITPEGERLTTEEDKATYLRTAQDWIVTPLLKTTPGLAGVDSIGGYAKQFLVVPDV
FT                   QKLASLGITLTDLGNALERNNTSVGGGFVNRNGEGLAVRSDALVRNASELARTVIATRN
FT                   GVPITVEQVATVKTGQAIRMGSASENGTEVVVGTAIMRIGENSRIVSTAVAEKLKTINA
FT                   SLPPDVVIQPVLNRTELVNSTIKTVAKNLSEGAVLVIVVLFLLLGNFRAALIAALVIPI
FT                   TMMLTGFGMLRAGVSANLMSLGALDFGLIVDGAVIIVENALRRLAEQQHHEGRLLSVKE
FT                   RLATVAAAAREMIRPSVYGQAIIILVYVPLLTLTGVEGKTFGPMALTVIIALAFAFILS
FT                   LTFVPAMIAIWLSKKVEEKDGRIITWLKKRYEPGLDRAMKRPTLTIGAGVGSLVVAALA
FT                   FTTLGSVFLPQLDEGDLLIQSLRIPATSVQQSQAMQVPIERMMSKQPEVQFVYSKTGTA
FT                   ELAADPMPPNATDMFVILKPRKDWPDPELPKEELVSRIEGNLAKIPGNAYEITQPIQMR
FT                   FNELIAGVRGDIAVKVFGDDFNQMNRTAEQIAAVLRRTQGAADVKVEQTTGLPMLDIRV
FT                   NRDAMARLGVTAQDVQDTVTATIGGRTSGQIFEGDRRFPVVIRLSEAQRADIGLLQQVQ
FT                   VPVAGGGYVPLSSVAEIKVVDGPNQISRENGKRRVVVQANVRGRDVGSVVADAQAAIGS
FT                   QLRLPAGTYLEWGGQFENLQSASERLKLVIPACFILILLLLYGALGSVRDAAIVFTGVP
FT                   FALVGGVLLLFLRGMDFSISAAVGFIALSGIAVLNGLVMVSSIQDLIRSGMSREEAAHV
FT                   GAMQRLRPVIMTALVASLGFVPMALGEGAGAEVQKPLATVVIGGLISATLLTLFVLPTL
FT                   YARFGQKVIEKPEHYNEEHEGDDHGQTFVNNLA"
     atgatcgccc gtatcgtaac ctgggcggtc gagaagcgct ggctagtcct gctcctcacc        60
     gtcatcgtcg ccgccatcgg cgccttttcc ctctaccggc taccgatcga cgcggtgccg       120
     gacatcacca acaatcaggt ccagatcaac gtccgcgcgc ctgccctctc gcccgagctg       180
     gtcgagaagc aggtgtcgtt tccaatcgaa accgcgctcg ccggcacccc cggcctggaa       240
     tatacgcgct cgttgagccg caacggcttc gcgcagatca cggcggtctt ttcggacgcg       300
     acggacatct atttcgcccg ccagcaggtg ggcgagcgtc tgcggggcgt gcaagagaat       360
     ctgcccgacg gcgtgaaccc tgaaatgggt ccgatcgcga caggcctggg cgaggtgtac       420
     atgtacaccg ttcgtctcga tcatcgcgag gacgacaagc acaagcccgg tgaaccgggc       480
     caacagcccg atggcagcta catcacgcca gagggcgagc gactgacgac cgaagaggac       540
     aaggcgacct acctgcgcac cgcgcaggac tggatcgtga cgccgcttct gaagaccaca       600
     ccgggcctcg ccggtgtcga ctcgattggc ggttacgcca agcagttcct cgtcgtgccc       660
     gacgtgcaga agctggcctc gctcggcatc acgctgacgg acctgggaaa tgcgctggag       720
     cgcaataaca ccagcgtcgg cggtggcttc gtcaatcgca atggcgaagg tctggctgtt       780
     cgctcggatg cgctcgttcg caatgccagc gagttggcca ggaccgtgat cgcgacacgt       840
     aacggcgtgc cgatcacggt cgaacaagtt gcgactgtga agacgggtca ggcgatccgc       900
     atgggttcgg catcggagaa cggtaccgaa gtcgtcgtcg gcacggcgat catgcggatc       960
     ggcgagaaca gccgcatcgt gtcgaccgcg gtcgctgaga aactgaagac gatcaacgct      1020
     tcgctgcctc ctgacgtcgt aattcagccg gtgctgaacc gcaccgagct ggtcaattcg      1080
     acgatcaaga cggtcgcgaa aaacctgtcc gaaggcgcgg tgctggtcat cgtcgtgctc      1140
     ttcctgctgc tcggcaactt ccgtgcggcc ctgatcgcgg cgttggtcat cccgatcacc      1200
     atgatgctga caggctttgg tatgctgcgc gctggggtct cggccaatct gatgagcctt      1260
     ggggctttgg acttcggtct gatcgtcgac ggcgccgtca tcattgtcga aaacgcgctg      1320
     cgccggcttg ccgagcaaca gcatcatgaa ggccgattgc tcagcgtcaa ggaacggctc      1380
     gcgaccgtgg cagccgctgc gcgtgagatg atccgtccct ctgtgtacgg gcaggcaatc      1440
     atcatcctcg tctacgtacc gctgctcacg ctgaccggcg tggagggtaa aacgttcgga      1500
     ccgatggcgc tgaccgtcat catcgcgctc gccttcgcct tcatcctctc tctcaccttc      1560
     gtgccggcga tgattgcgat ctggctgtcg aagaaggtcg aggagaagga cggccgcatc      1620
     atcacgtggc tgaagaagcg ctacgaaccc ggtctcgacc gggccatgaa gcgcccgacg      1680
     ctgacgatcg gtgcgggtgt gggaagcctt gtggtggcgg cgcttgcttt cactacgctc      1740
     ggctcggtgt tcctgccgca gctcgacgaa ggcgatttgc tgatccagtc gctccgcatt      1800
     ccggcaacgt cggtccagca gagccaggcg atgcaggtgc cgatcgagcg gatgatgtcg      1860
     aagcagccgg aggtgcaatt cgtctattcc aagacgggca ccgccgagct ggcggccgac      1920
     ccgatgccgc cgaacgcgac cgacatgttc gtcatcctga agccgcgcaa ggattggccg      1980
     gatcctgagc ttcccaagga ggagctggtc agccggatcg agggtaatct cgcgaagatt      2040
     ccgggaaatg cctacgagat cacccagccc atccagatgc gcttcaacga gctgatcgcc      2100
     ggcgtgcgcg gcgacatcgc ggtgaaggtg ttcggggacg acttcaacca gatgaaccgg      2160
     acggccgagc aaatcgcggc ggtgctgcgc agaacgcaag gcgcagcgga cgtgaaggtg      2220
     gagcagacga ccggtcttcc catgctcgac attcgcgtca accgcgacgc gatggcgcgg      2280
     ttgggcgtta cggctcagga tgtgcaggac accgtgactg cgacgatcgg cgggcgaaca      2340
     tcgggccaga tcttcgaggg cgaccgtcgc ttccccgtgg tgatccgcct gtcggaggcg      2400
     cagcgtgccg acatcggcct gctccaacag gtgcaggtgc cggtggcagg cggcggctat      2460
     gtaccgctgt ccagcgtcgc cgagatcaag gtggtcgatg gtccgaacca gatcagccgc      2520
     gagaacggca agcggcgcgt ggtggtgcaa gccaacgtgc gtggccgcga cgtcggatcc      2580
     gtcgtggcgg atgcgcaggc ggcgatcggc agccaactcc ggctgcctgc cggcacctat      2640
     ctcgaatggg gcggccagtt cgagaacctc caatcggcaa gcgaacggct gaagctggtc      2700
     attccggctt gcttcatttt gatcctgctg ctcctctacg gggcgttggg atcggtccgc      2760
     gacgccgcga tcgtgttcac cggcgtgcct ttcgcgctgg tgggcggcgt cctgttgctg      2820
     ttcctgcggg gcatggactt ctcgatctcg gcggcagtgg gcttcatcgc cctctcgggc      2880
     atcgcggtcc tcaacggcct cgtcatggtc agctcgatcc aagatctgat ccgatcaggg      2940
     atgagccgcg aggaagccgc gcatgttggc gcgatgcagc gtctgcgacc cgtcatcatg      3000
     accgcgctag tcgccagcct cggcttcgtg ccgatggcgc tgggcgaagg cgccggcgca      3060
     gaggttcaaa agcctttggc gacggtcgtc atcggcggtc tgatctcggc gacgcttctt      3120
     acgctgttcg tgctgccgac actctatgcc cggttcgggc agaaagtgat cgagaaaccc      3180
     gagcactaca atgaggagca tgaaggggac gaccacggtc agaccttcgt gaacaacttg      3240
     gcctga                                                                 3246
//

If you have problems or comments...

PBIL Back to PBIL home page