(data stored in ACNUC7421 zone)

EMBL: AP010803.PE543

AP010803.PE543       Location/Qualifiers
FT   CDS_pept        complement(550777..551403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05430"
FT                   /product="CDF-family cation efflux system protein"
FT                   /note="Co/Zn/Cd efflux system component / putative integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05430"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95377"
FT                   /db_xref="GOA:D4YYE5"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYE5"
FT                   /protein_id="BAI95377.1"
FT                   /translation="MNASTESCGCHGEPARAQTDPAYRRALLTVVVLNLGFGVAELFGG
FT                   FIADSQALKADSLDFLGDGSISLIGLLALAWSARARAKVALTQGLFLGALGVGVIGFAI
FT                   WRALNATAPDAELMGTIGVVALAINVVSALVLARFREGDANVRAIWLFSRNDALANVAV
FT                   IAAAGLVAWTGSAWPDLAVAGLIALLFLHSAYEIVTGARRELGER"
     atgaatgctt ctaccgaaag ctgcgggtgc cacggggagc ccgcgcgcgc gcaaaccgat        60
     ccggcctatc gccgtgcgct gctgaccgtc gtggtgctca acctcggctt cggagtcgcc       120
     gagctgttcg gcgggttcat cgccgatagc caagcgctga aagcggattc cctcgatttt       180
     ctcggggacg ggtcgatcag ccttatcggt cttctcgcgc ttgcctggtc cgcacgggcg       240
     agggcaaagg tcgcgctgac gcaggggttg tttctcggtg cgcttggcgt gggcgtaatc       300
     ggtttcgcga tttggcgcgc cctgaacgca accgcgcccg atgccgaact gatgggcaca       360
     atcggcgttg tcgcgctcgc gatcaatgtc gtgtccgcct tggtgcttgc gcgtttccgg       420
     gaaggggacg ccaatgttcg cgcgatctgg ctgttcagcc gcaacgacgc gctcgccaac       480
     gtggcggtga tcgccgcggc cggtctggtg gcgtggacag gaagcgcctg gccggacctc       540
     gccgtcgccg gcctcatcgc cctcctgttc ctccactccg cttatgaaat cgtcactggc       600
     gctcggcgcg aattgggaga gcggtag                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page