(data stored in ACNUC7421 zone)

EMBL: AP010803.PE545

AP010803.PE545       Location/Qualifiers
FT   CDS_pept        complement(551892..553094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05450"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95379"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYE7"
FT                   /protein_id="BAI95379.1"
FT                   /translation="MSRRSLVARLVACGTGLVLGSPTLARQTSRSAGSWNFGAAHLEWE
FT                   PLEVGTGDTLLVSAQVRGVPVRAVLDSGSGASIMSTALAAKLGLNDGERRMISGLSAKA
FT                   PVLLVRDIDVQLARETRRLPFAVVGDLSSVSAAFGRPIDILLGADMFTGSCIALDFAKR
FT                   RMAVVKSGTFLAGPDWRAVALGRGAKQELFIRASVSGLPPVPLMIDLGSSAALMLSSAY
FT                   ARDQGLLNGKLVSTAAIGGVDGVRINDAFTIQNINIEGLGVSNVPTLGMRAWLSTSTVG
FT                   NVGLPLIAQFDVVFDVTAGFVWLRPLGPRRRLPMLKDRSGLGLAASPTALTVVHVAANS
FT                   PAEKAGWAVGDRIVAVNGHSIDANYTRGELWQVRSRPAGTLVKLTMASGDVRELRLADY
FT                   Y"
     atgtctcgac gctcattagt ggcgcggctg gtggcctgtg gaaccggctt ggtgctcggt        60
     tctccaacgc tcgcgcgaca gacttcccgg tctgcgggct cgtggaactt cggtgcggct       120
     cacctcgaat gggagccgct ggaagtcggc acgggtgata ccctccttgt ttcggcacaa       180
     gtgcgcggag tgccggtgcg ggcggtgctc gacagtggca gcggcgcgtc gatcatgagc       240
     acggcgctcg cggcgaagct cggcttgaac gatggtgagc ggcgcatgat tagcgggctg       300
     agcgccaagg ccccggtgct gctggtccgc gacatcgacg tacagctcgc ccgcgaaacc       360
     cgtcgcttac cctttgccgt cgttggtgat ctgagttcag tgtcggcggc cttcggacga       420
     ccgatcgata tcctcctcgg tgccgatatg ttcacgggta gctgcatcgc gctcgatttc       480
     gcgaaaaggc gtatggcggt cgtcaagtca ggcacgtttc tcgccggtcc cgactggcgc       540
     gctgtcgcgc tcgggcgcgg tgccaagcag gagctgttca ttcgagcttc cgtctcgggt       600
     ttgcctcccg tgcccttgat gatcgatctt ggcagctcgg ccgcgctgat gctctcgtcg       660
     gcctatgccc gcgatcaagg gctgttgaac gggaagctcg tctcgaccgc ggcgatcggc       720
     ggcgtcgatg gtgtgcgtat caacgatgct ttcacgatcc agaacatcaa catcgaaggg       780
     cttggcgtct cgaacgtccc cacactcggg atgagagctt ggctctccac cagcacggtt       840
     ggcaatgtcg gcctaccgct gatcgctcaa ttcgacgtgg tgttcgacgt gaccgccgga       900
     ttcgtgtggc tccggccact cggtcctcgt cgtcgcctgc cgatgctgaa ggaccgtagc       960
     ggccttggcc tcgcagcctc accaacggcg ctcaccgttg ttcatgtggc ggcgaacagt      1020
     cccgcggaaa aggctggctg ggcggtcggc gaccggatcg tggcggtgaa cggccattcg      1080
     atcgatgcga actatacgcg tggggagctc tggcaagtgc gctcccggcc tgctggcacc      1140
     ctcgtaaagc tgacgatggc ctcgggtgat gtgcgcgagc tcaggctggc cgattattat      1200
     tga                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page