(data stored in SCRATCH zone)

EMBL: AP010803.PE546

AP010803.PE546       Location/Qualifiers
FT   CDS_pept        complement(553384..553956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05460"
FT                   /product="invertase/recombinase like protein"
FT                   /note="site-specific recombinase, DNA invertase Pin
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05460"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95380"
FT                   /db_xref="GOA:D4YYE8"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYE8"
FT                   /protein_id="BAI95380.1"
FT                   /translation="MKIGYARVSTAEQNLDLQRDALKAAGCEKVITDKASGATAARPGL
FT                   EKVKELLRAGDTLVVWRLDRLGRSLRDLIGWMTYLDEEKVGLLSLHEAIDTTTTSGKLT
FT                   FHLFGALAEFERNLIRERTQAGLTAARARGKKGGRPAALGKDKRDLPVRLYHENTMPIA
FT                   KICSMLGISKPKLYAYVRSAETKPVAA"
     atgaaaatcg gttacgcccg cgtatcgacc gccgagcaga acctggacct ccagcgtgat        60
     gcgctgaagg ctgccggctg cgagaaggtc atcaccgaca aggcctccgg ggcgactgcc       120
     gctcgccctg gattggaaaa ggtgaaggag ctgcttcgcg ccggcgacac actggtggtc       180
     tggcgcctcg acaggctcgg ccgctcgctc cgtgatctga tcggatggat gacctacctc       240
     gacgaggaaa aggtcgggct gctgagcctg cacgaggcga tcgacacgac caccacgtcg       300
     ggcaagctta ccttccacct gttcggggca ttggcggagt tcgagcgcaa cctgatccgc       360
     gagcggaccc aggccggtct caccgcagcc cgcgctcgcg gcaagaaggg tggccggccg       420
     gccgcactcg gcaaggacaa gcgcgacctg cccgtcaggc tctaccacga gaacacgatg       480
     ccgatcgcca agatttgttc gatgctcggc atctccaagc caaaactcta cgcctatgtg       540
     cgatcggccg agaccaagcc ggtagccgcg tag                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page