(data stored in ACNUC7421 zone)

EMBL: AP010803.PE55

AP010803.PE55        Location/Qualifiers
FT   CDS_pept        complement(54832..55257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00550"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00550"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94889"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="InterPro:IPR008228"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX07"
FT                   /protein_id="BAI94889.1"
FT                   /translation="MDFWEKPLDKLDRAEWEALCDGCGKCCLHKAEDEDTGRIYPTNVA
FT                   CRLLDRHSGQCTNYKERRRFVPDCVRLTPAKVKTIGWLPRTCAYRLRGEGKPLPQWHYL
FT                   VCGDREAVHRAQESVRGWTVAEADAGDWENHLVDREL"
     ttggacttct gggaaaagcc cctcgacaaa ctggaccgcg ccgagtggga agcgctgtgc        60
     gacggctgcg gcaaatgctg cctccacaag gcggaggatg aggataccgg ccgcatctat       120
     cccaccaatg tcgcctgccg cctgcttgac cggcacagcg gccaatgcac caactacaag       180
     gaacgccgcc gcttcgtgcc ggattgcgtg cgcctgaccc ccgcgaaggt gaagacgata       240
     ggctggctgc cccgcacctg cgcctacagg ctgcgcggcg agggcaagcc gctgccgcaa       300
     tggcattatc tggtctgcgg cgaccgggaa gcggtgcacc gggcgcagga gtccgtgcgc       360
     ggctggaccg ttgcggaggc ggacgcgggc gattgggaaa atcaccttgt cgacagagag       420
     ctctga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page