(data stored in ACNUC7421 zone)

EMBL: AP010803.PE550

AP010803.PE550       Location/Qualifiers
FT   CDS_pept        complement(557983..558576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpR"
FT                   /locus_tag="SJA_C1-05500"
FT                   /product="resolvase"
FT                   /note="invertase/recombinase like protein / site-specific
FT                   recombinase, DNA invertase Pin homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05500"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95384"
FT                   /db_xref="GOA:D4YYF2"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYF2"
FT                   /protein_id="BAI95384.1"
FT                   /translation="MALIGYARVSTADQKLSLQLDALNAAGCDRIFDDHASGAKADRPG
FT                   LAEALAYLRSGDTLVVWKLDRLGRSMSHLIEKVGELATRGIGFRSLTENIDTTTSGGML
FT                   VFNIFGSLAQFERDLIRERTHAGLKAARERGRPGGRRPVVTPDKLRKAREHIASGLTVR
FT                   EAAARLKIGKTALYKALEATEKNTKSQRSRSVRS"
     gtggcgttga tcggctatgc gcgcgtctcg acggcagacc agaagctctc actccagctc        60
     gacgcgctga acgcggccgg gtgcgaccgg atattcgacg atcacgcatc tggtgcaaaa       120
     gccgatcggc ccggcctggc cgaggcgctc gcctatctgc gcagcggcga cacgctggtg       180
     gtttggaaac tcgaccgtct tgggcgctcg atgagccatc tgattgagaa ggtcggcgag       240
     ctagcgacgc gaggtatcgg gttccgctcg ctcaccgaga acatcgacac caccacttcg       300
     ggcgggatgc tggtgttcaa catcttcggc tcgcttgccc agtttgagcg cgatctgatc       360
     cgggagcgca cccatgcagg cctcaaggcc gctcgcgagc gaggtcgccc cggtgggcgg       420
     cggccagtgg tcacacctga caagctccgc aaggcgcgcg aacatatcgc ttccggcctc       480
     acagttcgcg aggccgccgc gcgcctcaag atcggcaaaa ccgccctcta caaagccctc       540
     gaagccacgg agaagaacac aaagtcccag cgttcccggt ccgttcgctc ttag             594
//

If you have problems or comments...

PBIL Back to PBIL home page