(data stored in ACNUC7421 zone)

EMBL: AP010803.PE554

AP010803.PE554       Location/Qualifiers
FT   CDS_pept        complement(562738..563379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05540"
FT                   /product="hypothetical protein"
FT                   /note="ethyl tert-butyl ether degradation EthD"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05540"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95388"
FT                   /db_xref="InterPro:IPR009799"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYF6"
FT                   /protein_id="BAI95388.1"
FT                   /translation="MTPQAFHDHWRYPHGSLGQGIRIIKRYVQSHQVDVDFLDADQNRY
FT                   EGIAEVWFDSEADAAAFVTDPDYVAYALKDEPNFVDMDNFFAVFAREEVLKSRAEALRG
FT                   DEAAYNWSIDRRPNFAKLTQVVFEEGGTAWAGDDDFALGERLGAFRHTRCHPIEKLVLP
FT                   GPSVIGVRELYWPTRTLAEQGIAAAGDAFHALFSRAPKAQTIFSISERYV"
     atgacgcctc aggcgtttca cgatcactgg cgctatcccc acggctcgct gggacaaggc        60
     atccggatta tcaagcgcta tgtccagagc catcaggtcg acgtcgattt cctcgatgcc       120
     gatcagaacc gctacgaagg catcgccgaa gtctggttcg acagcgaagc ggacgctgcc       180
     gccttcgtga ccgatcctga ttatgtggcc tatgcgctga aagatgagcc gaatttcgtc       240
     gacatggaca acttctttgc cgttttcgca cgcgaagagg ttctcaaaag ccgcgccgaa       300
     gcgctgcgcg gtgacgaggc ggcctataac tggtcgatcg accgacgacc gaacttcgcc       360
     aagcttaccc aggtggtgtt cgaggaaggc ggcacggcct gggccggaga cgacgatttc       420
     gcacttggcg agcgtcttgg cgcatttcgc catacccggt gccatccgat cgaaaagctc       480
     gtcctccccg gcccctcggt gatcggtgtg cgcgaacttt attggccgac gcggacattg       540
     gcagaacagg gcatagctgc agcaggtgac gctttccatg cgctgtttag ccgagcgcca       600
     aaggcacaaa cgatcttctc gataagtgag cgctacgtct ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page