(data stored in ACNUC7421 zone)

EMBL: AP010803.PE555

AP010803.PE555       Location/Qualifiers
FT   CDS_pept        complement(563452..564213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05550"
FT                   /product="LinC-like SDR-family protein"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05550"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95389"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYF7"
FT                   /protein_id="BAI95389.1"
FT                   /translation="MSGLEQRSYIVTGAGGSIGRAAALILARRGANVVVADIVEAAAEE
FT                   TVRLIRAEGGNAVYSHCDVSIEDNAWSTVELAITEFGRLDGAFNNAGLPPVNVPLHQLT
FT                   SADFQRSLDINVLGVFHCMKHQIAAMLKAGSGGSIVNTASVGGTVAIPAHGEYIAAKHA
FT                   VIGLTRIAAVDYGQQGIRVNAVLPGAIRTPMLMSVIENEPSHAEFLKTAHPIGRYGEPA
FT                   EIGETAAWLLSDASSFVTGAAIAADGGYTAI"
     atgtccggat tggagcaacg cagctatatc gtgacgggcg caggcggcag tatcggccgc        60
     gctgccgccc ttattcttgc ccgtcggggc gcgaatgtgg ttgtcgccga tatcgtcgaa       120
     gccgcagccg aggaaacggt cagactgata cgcgcggaag gtggcaacgc cgtctacagc       180
     cattgcgacg tcagtatcga ggacaacgcg tggtcgaccg tggaactcgc catcaccgaa       240
     ttcggtcgcc ttgatggcgc attcaacaat gcggggctgc cgccggtcaa cgtgccgctt       300
     catcaactga cgagcgccga tttccaacga tccctggata tcaacgtgct cggcgttttt       360
     cattgcatga aacatcagat cgcagcgatg ctgaaagcgg ggagcggcgg ttcgatcgtg       420
     aacacggcgt cggttggcgg caccgtcgcg atccccgcac atggcgagta catcgcagcc       480
     aaacatgccg ttatcgggct gacgcggatc gctgccgtcg attacgggca acagggaatc       540
     cgcgtgaacg cagttctacc gggcgctatc cgcactccga tgctgatgtc ggtgatcgag       600
     aacgagcctt cgcacgcgga attcctgaaa accgcccacc cgatcggtcg atatggcgaa       660
     ccggcggaga tcggcgaaac ggcagcctgg ttgctgtcgg atgcctcttc gttcgtcacc       720
     ggcgccgcca ttgctgccga tggcggctac accgcaatct ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page