(data stored in ACNUC7421 zone)

EMBL: AP010803.PE556

AP010803.PE556       Location/Qualifiers
FT   CDS_pept        complement(564260..565525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05560"
FT                   /product="putative dioxygenase"
FT                   /EC_number="1.14.12.12"
FT                   /note="phenylpropionate dioxygenase or related
FT                   ring-hydroxylating dioxygenase, large terminal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05560"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95390"
FT                   /db_xref="GOA:D4YYF8"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYF8"
FT                   /protein_id="BAI95390.1"
FT                   /translation="MNEMTELASICTSDLTQTAGLGTGPVSCEPYRSPAYFERERENLF
FT                   KRAWLTVGRVEQLPEKGSFFTKTIEIWNAPIVVTRGSDDRIQAFYNVCAHRGNQVVLTE
FT                   RGRASRFSCNYHNWVYRNDGSLMGVPDEANFFDLDKKKCGLVPIATDVWEGWIFLNHQK
FT                   QPEVSLQEFLGDFGTRFAGVSWENTDTSLYFEAHLDANWKVLADAFSETYHIPSIHPAT
FT                   IGKTFASAVNPHSRPLDARFWGPHRQFSTFGNPDYAPPEDAMVEKMAYANRDTGNVLGA
FT                   AETAGMTEYLDHPAINPKQSKHWALDIAVAFPTLHINLSPGGFWSHRFWPISVNRTRWE
FT                   AEFHVPKPLTGREKLQQELYITRIAGILLEDVTNTERTQRGIEAGAYDTMQLQDGEVQI
FT                   RHNLHHVDRWVNARTVREALGI"
     atgaacgaga tgaccgagct tgccagcatc tgcaccagcg atctgacgca aaccgccgga        60
     ctgggcaccg gtccagtctc ctgcgagcct tatcgttcac ccgcctattt cgagcgagaa       120
     cgcgaaaatc tgttcaagcg cgcctggctg accgtgggcc gggtggaaca gcttcccgaa       180
     aagggcagct tcttcaccaa gaccatcgag atctggaacg cgccgatcgt ggtgacgcgc       240
     ggcagcgatg acagaattca ggcgttctac aatgtctgcg cccatcgcgg caatcaggtg       300
     gtgttgaccg agcgcggccg cgcctcgcgc ttctcctgca attaccacaa ctgggtctac       360
     cgcaacgacg gcagcctgat gggcgtgcca gacgaggcga acttcttcga tctcgacaag       420
     aagaaatgcg gcctcgtgcc gatcgccacc gatgtgtggg aaggctggat attcctcaac       480
     caccagaagc agcccgaagt cagcctgcag gaattccttg gagacttcgg aacgcggttt       540
     gccggggttt cttgggaaaa tacggatacg tcactctatt tcgaggcgca tctcgatgcg       600
     aactggaaag tgctggccga tgccttttcg gaaacctacc atatcccttc gatccacccg       660
     gcgacgatcg gcaagacttt cgccagcgcg gtcaatccgc attcccgccc gctcgatgca       720
     cgcttctggg gaccacaccg ccagttttcc actttcggca atccggacta cgctccgccc       780
     gaagatgcga tggtcgaaaa gatggcctat gcgaaccgcg ataccggcaa cgtgctgggt       840
     gccgcggaaa cggcggggat gaccgagtat ctcgatcatc ccgcgatcaa tcccaagcaa       900
     tcgaaacact gggcgctgga catcgccgtc gcttttccca cgctgcacat aaacctttcg       960
     cccggcggtt tctggtcgca caggttctgg ccgatcagcg tcaatcgcac gcggtgggaa      1020
     gccgagtttc atgtacccaa gccactgacc gggcgggaaa agctgcaaca ggaactctat      1080
     atcacgcgca tcgcgggaat cctgctggag gacgtgacga acaccgaacg cacccagcgc      1140
     ggcatcgagg ccggcgcata cgatacgatg cagttgcagg atggcgaagt acagatccgc      1200
     cacaaccttc accacgtcga tcgctgggtg aacgccagga ccgtgcgcga agcgctgggc      1260
     atctga                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page