(data stored in ACNUC7421 zone)

EMBL: AP010803.PE557

AP010803.PE557       Location/Qualifiers
FT   CDS_pept        complement(565539..565901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05570"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95391"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYF9"
FT                   /protein_id="BAI95391.1"
FT                   /translation="MPAPALDEEPVLPPGFEDLLEFVPHWIGETAQERWDIRARATMAE
FT                   ITRFYDVLLSRSEAILDHVETFPLDAMPAPTLRLFRLQLALAHAAMSVELHKQPRAHNS
FT                   PYPHQVRILRTAEPTL"
     atgccggccc ccgcgctcga cgaggagccc gtgctgcccc ccggcttcga ggatcttctc        60
     gaattcgtgc cgcactggat cggcgagacg gcgcaggaac gatgggatat ccgggcgcgc       120
     gcgactatgg cggagataac ccgcttctac gatgtgctgc tctcccgttc ggaagccatc       180
     ctcgaccatg tcgagacctt tccgctcgac gcgatgccgg cgccgacgct gcgcctgttc       240
     aggctacagc tggcgctggc tcacgcggcg atgtccgtag aattgcacaa gcagccgcgc       300
     gcgcacaatt cgccctatcc gcaccaggtc cgcatcctgc ggacggcaga gccaacgctg       360
     taa                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page