(data stored in ACNUC7421 zone)

EMBL: AP010803.PE560

AP010803.PE560       Location/Qualifiers
FT   CDS_pept        complement(567401..568177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05600"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor protein, mostly Fe
FT                   transport"
FT                   /note="remnant"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05600"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95394"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYG2"
FT                   /protein_id="BAI95394.1"
FT                   /translation="MQQSPKGYKAGSFPGVSAGTFAQYAAVTQESLVDYEAGFKTTLFD
FT                   RKVTLNGGVFYYDYKNKQLRAKIVDPFFNALDGLVNVPKSRVKGAELELSARVVEGLTV
FT                   SAAATYIDAKVRHYQGIVGSVANEVGLFDPIRGDFSGARLPFSPKWQSSLSADYSLPLG
FT                   GVNLTMGTTISSQSKSLGVLAITNADKDLYEVNGRTLVSARLGVEAPDGRWAVFGWGRN
FT                   IFNKYYLTNTIQTYDTVVRYAGRPAEYGMTVRFKFQ"
     ttgcaacaga gcccgaaagg gtacaaggcg ggaagtttcc cgggcgtctc cgccggaacg        60
     ttcgcgcaat atgccgccgt cacgcaggaa tcgctggtcg attacgaagc aggcttcaag       120
     accacactgt tcgatcgcaa agtgacgctg aatggcggcg ttttctatta tgactacaag       180
     aacaagcagc tgcgcgccaa gatcgtcgat ccgttcttca atgcgctgga tggcctggtc       240
     aatgtcccca agtcgcgcgt caagggtgcc gaactggaac tgagcgccag agtggtcgag       300
     gggctcacgg tcagtgcggc cgcgacctat atcgacgcca aggttcgcca ctatcagggg       360
     atcgtcggct ccgttgccaa cgaagtgggc ctgttcgatc cgatccgggg cgatttcagc       420
     ggcgcacggc tgccgttttc gcccaaatgg caatcgagcc tgagcgcgga ctacagcctg       480
     ccgctgggtg gcgtgaacct aaccatgggc acgacgatct cctcacaaag caaatcgctg       540
     ggcgttctgg ccatcaccaa cgcggacaag gatctctacg aggtgaatgg ccgcacgctc       600
     gtttccgcgc ggcttggcgt ggaagcgcct gatggccgct gggcggtctt cggctggggt       660
     cgcaatatct tcaacaagta ttacttgaca aacacgatcc agacttacga taccgttgtt       720
     cgctacgctg gtcgacccgc cgaatatggc atgaccgtgc gcttcaagtt ccagtaa          777
//

If you have problems or comments...

PBIL Back to PBIL home page