(data stored in ACNUC7421 zone)

EMBL: AP010803.PE563

AP010803.PE563       Location/Qualifiers
FT   CDS_pept        complement(573909..574199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05630"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95397"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYG5"
FT                   /protein_id="BAI95397.1"
FT                   /translation="MQVRCIGAIGRCKFKNPQNSFRDDLSAANFISNRRTEINLVRQFS
FT                   GPMLAINSSSKFRFSSAIASLLHSSNVPQCRCSCRSRSLPGNRDFLQNGLG"
     atgcaagttc gatgcatcgg cgcaattgga cgatgcaaat tcaagaaccc gcaaaattcg        60
     ttccgcgacg atctgtcggc tgccaacttc atttccaacc ggaggaccga aatcaatctc       120
     gtccggcagt tttctgggcc gatgttggcg atcaactcat cgagcaaatt ccgtttttcg       180
     tcagccattg cgtcactcct ccattcgtcc aacgtgcctc aatgtcgctg ttcatgcaga       240
     agccgatcac tgcccggtaa tcgcgacttc ctccaaaatg gcctcggtta g                291
//

If you have problems or comments...

PBIL Back to PBIL home page