(data stored in ACNUC7421 zone)

EMBL: AP010803.PE564

AP010803.PE564       Location/Qualifiers
FT   CDS_pept        574788..575819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05640"
FT                   /product="Fic-family protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05640"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95398"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR025758"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYG6"
FT                   /protein_id="BAI95398.1"
FT                   /translation="MLGRAEALAASLPDPYIISRTLSRREAVDSSAIEGTNSTLDELLT
FT                   IEEEDDDARDAARQVRDYALTLDRLLPRAAAEGIDIFTVQMIQELHHEAMQHDPEYPDS
FT                   AGALRNIVVWIGGTGHISTSTYNPAPPGQVGACLEDTAAYMRCEGMQAMTQSLITRMAI
FT                   AHAHFEAVHPFRDGNGRVGRLLLPMMMAAEGQVPLYLAPYIAANRDGYYSGLKIAQQRL
FT                   EWGPLVGYLSDAITGTVEELFATRDGLNALKEQWRGRRKFRSNSAALRALDLLSDYPVV
FT                   TMKRLAQKLGVSRPQALSAINQLMEAGILSERTGYSRNRIFAAQEVLAIVNRPFGSNPS
FT                   ERS"
     atgctcggac gtgccgaagc cctcgcggcg agcctgccgg acccctatat tatcagccgt        60
     acgctgagcc gtcgcgaagc agtcgacagc tcggccattg aaggcacgaa cagcacgctc       120
     gacgaactcc tgacaatcga ggaagaggat gacgacgcgc gcgacgccgc ccgtcaggta       180
     cgggactatg cgctgaccct cgatcgcctc ctgcctcgtg ctgcagccga gggcatcgac       240
     atctttacag tgcagatgat ccaggaactc caccacgagg cgatgcagca cgacccggaa       300
     tatcctgatt cggcaggggc gctgcgcaat atcgtggtct ggatcggcgg tacgggtcat       360
     atttcgacat cgacctataa tccggcgcca cctgggcagg tgggggcctg ccttgaggat       420
     acggccgcct atatgcgctg cgaaggcatg caggcgatga cgcagagcct gatcacccgc       480
     atggcgattg cccatgcgca tttcgaagcg gtacacccct tccgagacgg caacggtcgt       540
     gttggccgcc ttttgctgcc gatgatgatg gcagcggaag ggcaggtgcc gctctatctc       600
     gcaccctata tcgccgcaaa ccgcgacggc tattattcgg gcctcaaaat cgctcaacaa       660
     cggctcgaat ggggaccgct cgttggctat ctgtccgatg ccataactgg aacggtggaa       720
     gaactcttcg caacgcggga tgggttgaat gccttgaagg aacagtggcg cgggcgaagg       780
     aagttccgat cgaactccgc tgcactgcgg gcactggacc tccttagcga ctatcccgtc       840
     gtcactatga agcggctggc tcagaaactt ggagtatcgc gaccgcaggc cctttccgca       900
     attaaccaac tgatggaggc aggcatcttg tcggagcgga ccggctacag tcgcaaccgg       960
     atctttgcag cccaagaagt cctggccatc gtcaacaggc ctttcggcag caatccttcc      1020
     gagcgatcgt ga                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page