(data stored in ACNUC7421 zone)

EMBL: AP010803.PE567

AP010803.PE567       Location/Qualifiers
FT   CDS_pept        complement(577626..580052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05670"
FT                   /product="putative dehydrogenase/reductase"
FT                   /note="uncharacterized NAD(FAD)-dependent dehydrogenase /
FT                   pyridine nucleotide-disulphide oxidoreductase family
FT                   protein / putative ferredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05670"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95401"
FT                   /db_xref="GOA:D4YYG9"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR021095"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYG9"
FT                   /protein_id="BAI95401.1"
FT                   /translation="MASERFDFLLLGGGLASATAAETLRREGAIGTIGILSAEEFPPYH
FT                   RPRLSKQYLIGTSTDVDILVHPVDYYRQQNISLVLGAEVTAVDPASRTVRTDDGDSFEY
FT                   GKLLIATGAAPRRLDVSGADKEGVFYLRRKVDCDVVRKAAQPGRKVVVLGASFLGMEIA
FT                   LSLIELGLEVTMLDIATRVLPHLEAPAISTFFQGYAEGKGATILLDDTAVEVIGDGHVA
FT                   GVRTQKGREIPCDMVIVSVGVMPATSFLDGSGILLEHGFVAVDDRLRTNTEDVFAAGDV
FT                   TSFYDPVFRRRRHIEHWDNAVRQGRLAARNMIGRRLRYDEVSYFYCEMGELGFDMLGIP
FT                   ENAEDWISRGDLKDGSYALFYLRDDVPQAAFSMGRPSSEIRVAEGLIRYRVNLERYRDQ
FT                   LGDPAYLLETIPAQKVLVLQGGGALGAFECGVVHALEEEHIFPDIVAGVSIGALNGAII
FT                   AGNPRHSTEALQSFWNDLTVVAPPLPFAEMRRAAVGAQILAFGVPKFFKPRWMPPFDFL
FT                   APWTGYYDTSPMRRLIAQYVDFSSLKSSPVRLLVGAVNVTTAQLEVFDSYIDDLTPDHV
FT                   LASGSLPPGFSWTVVDGTAYWDGGIVSNSPLDLVLDRCGPDGKRIYIVDLFAGDAPLPT
FT                   NMIEVLARRDEVVYSERVRSDLRIREMTDAYRSMINIILSGIDQVERAKIMRHPRFIQL
FT                   MGDGFTNEITRFQRPRRPGEASSRDYDFSDESIRRLQAEGYDLVKQTLVKTSKAGVSAT
FT                   PKASSALEEIKHAEAAAGTAAGRSLSGADAVLQTIAQAAPVLGTPRKRKSKKESP"
     gtggcaagtg agagattcga tttcctgctg ctgggcggcg gtttggccag cgcgacagcg        60
     gcggagacgt tgcggcgcga gggcgccatt ggcacgatcg gcatcctctc ggctgaggaa       120
     ttcccgccat atcatcgtcc cagactgtcg aagcaatatc ttatcggaac gtcgacggac       180
     gtcgatatcc tcgtccatcc tgtcgactac tatcgccagc agaacataag cctcgtcctc       240
     ggcgccgagg tgacagccgt cgatccggcg tcacggacgg ttcggacaga cgacggcgac       300
     tcattcgagt atggcaaact gctgatcgcc acgggcgccg ccccgcgtcg ccttgacgtg       360
     tcgggcgcgg ataaggaggg ggtcttctac cttcggcgca aagtcgattg cgacgtcgtg       420
     cggaaagcgg ctcagccagg ccgtaaggtg gtggtactcg gtgcgagttt cctcggcatg       480
     gaaatcgcgc tctcgctgat cgagttgggc ctggaggtga cgatgctcga catcgccacg       540
     cgggtgttgc cgcatctgga agcgccggcg atctcgacct tcttccaggg atatgctgaa       600
     gggaaagggg cgacgatcct gctcgacgac acggcggtcg aggtgatcgg ggacggccac       660
     gtggcggggg tccgcacgca aaaagggcgc gaaatcccgt gcgacatggt gatcgtcagc       720
     gtcggagtca tgccggccac cagttttctc gatggtagcg gtattctgct tgagcatggc       780
     ttcgtcgccg ttgacgacag actgcgcacg aacaccgagg atgtctttgc ggcaggcgac       840
     gttacgtcct tctacgatcc agtgtttcgg cgtaggcgcc atattgagca ttgggacaat       900
     gctgttcgcc aggggcgcct tgccgcccgg aatatgatcg gacgtcggct ccggtacgat       960
     gaagtttcct acttctattg cgaaatgggc gagttgggct tcgacatgct tggcattccg      1020
     gagaacgccg aggattggat cagtcgaggc gacctgaagg atggttccta tgcgctcttt      1080
     tatctgcgcg acgacgttcc gcaggccgcc ttctccatgg gccgcccgtc aagcgagatc      1140
     cgggtagccg aggggctgat ccgataccgg gtcaaccttg agcgatatcg ggaccaactc      1200
     ggcgatccgg catacctgct cgaaaccatt cccgcgcaga aggtgctcgt cttgcagggc      1260
     ggaggcgcgc ttggtgcgtt cgagtgcggc gtcgttcacg cgctggagga agagcatatc      1320
     ttcccagata ttgtcgcggg cgtgtcgatc ggcgcgttaa atggcgccat catcgccgga      1380
     aatccccgcc actccaccga agcgctccaa tcattctgga atgaccttac agtcgtcgcg      1440
     ccgccgttgc catttgcgga aatgcgtcgc gccgccgtcg gggctcagat cctggccttt      1500
     ggcgtgccaa agtttttcaa gccccgctgg atgccgccct tcgatttcct ggccccgtgg      1560
     accggctatt acgacacgtc gcctatgcgg aggctcattg cgcagtatgt cgatttctcg      1620
     agcctcaaga gcagcccggt cagactgctg gtgggcgcgg tcaacgtgac aaccgcgcag      1680
     ttggaagtct tcgacagcta catcgacgat ctgacgccgg atcatgttct ggcgagcgga      1740
     agcttgccgc cgggcttctc ctggacggtg gtggacggca cggcctattg ggatggtggt      1800
     atcgtcagca actcgccgct ggatctggtg ctcgatcggt gcggcccgga cgggaagcgg      1860
     atctatatcg tcgatctctt cgcgggcgac gcgccgcttc cgaccaacat gatcgaggtt      1920
     ctcgcgcggc gcgacgaggt cgtctattcc gaacgtgtgc gcagcgatct ccgcattcgc      1980
     gaaatgaccg acgcgtaccg cagcatgatc aacattattc tgtcgggcat cgatcaggtc      2040
     gagcgcgcga agattatgcg gcatccccgc ttcattcagt tgatgggcga cggcttcacc      2100
     aacgagatca cgcggttcca acgccctcgc agaccgggcg aagcgtcatc tcgcgactat      2160
     gacttctcgg acgaatcgat ccgacggctg caagccgaag gctatgattt agtaaagcag      2220
     acgctggtca aaaccagcaa ggcgggcgtg tcagccacgc ccaaagccag ttccgcgctc      2280
     gaagaaatca agcacgccga agcggcagca ggcacggcag ccggccgatc gctctcgggc      2340
     gccgacgcgg ttctccagac gattgcgcag gctgcgccag ttcttggcac cccgcggaaa      2400
     cggaaaagca aaaaggagtc tccatga                                          2427
//

If you have problems or comments...

PBIL Back to PBIL home page