(data stored in ACNUC7421 zone)

EMBL: AP010803.PE569

AP010803.PE569       Location/Qualifiers
FT   CDS_pept        581062..581436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05690"
FT                   /product="phasin-family protein"
FT                   /note="phasin 2"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05690"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95403"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYH1"
FT                   /protein_id="BAI95403.1"
FT                   /translation="MTANDSPPDSDVGARTLAAANLDRMHQVLDVAMKSGQSSLSAARA
FT                   NGVRASKLAVETTTKTIAYSQATAAASTEHLTRLMQVRDFKEAADLQAEFVRSRLAAFQ
FT                   DYLRDISKTAETALLDPTSE"
     atgaccgcga acgacagccc tcctgatagc gacgttggcg cgcggacgct ggccgccgcg        60
     aacctcgatc ggatgcacca agtcctcgac gtggccatga agtcgggaca gtcgtccctg       120
     agtgccgcgc gcgcaaacgg cgtgcgagcg agcaagctgg cggtggaaac gactacgaaa       180
     accatcgcct actcgcaggc gaccgccgca gcgagcaccg agcatctgac gcgcctgatg       240
     caggttcgag atttcaaaga ggcggcagat cttcaggcgg agttcgtccg ctcacgcctt       300
     gccgcgttcc aggactatct cagggacatc agcaagacgg cagagaccgc gctgttggac       360
     ccaacctcgg aatag                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page