(data stored in ACNUC7421 zone)

EMBL: AP010803.PE574

AP010803.PE574       Location/Qualifiers
FT   CDS_pept        complement(585737..586396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05740"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05740"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95408"
FT                   /db_xref="GOA:D4YYH6"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYH6"
FT                   /protein_id="BAI95408.1"
FT                   /translation="MRGYDASRLMLAIGLAAQAGFIDALGFLKLGGLFVSFMSGNSTRL
FT                   GVGLASGAAVAGMAAGLIGAFVGGVLAGALVARRAGRWRKQAVLGLSTALLVCAALLAL
FT                   PDGPGMGLTLLMTAAMGAVNNVFQRDGEVSIGVTYMTGALVKLGQQLAVALSGGPRWNW
FT                   LPYLLLWLGLVAGAVAGGGLFALMGLHALWVAVAFSGLLLLWSGRLGPLDKGRQAL"
     atgcgcggat atgatgcttc ccgcctcatg ctggccatcg gcctggcggc gcaggcgggg        60
     ttcatcgatg cgctggggtt cctgaagctc ggcgggcttt tcgtttcctt catgagcggc       120
     aattcgacgc ggctgggcgt agggctggcc agcggcgcgg cggtcgcggg aatggcggcg       180
     ggattgatcg gggcctttgt cggcggcgtg ctggcgggcg cgctggtcgc gcgccgggcg       240
     gggcgctggc gcaagcaggc ggtgctgggc ctttcgaccg cgctgctggt ctgcgccgcg       300
     ctgctggccc tgccggacgg gccgggcatg gggctgacgc tgctgatgac ggcggcgatg       360
     ggcgcggtga acaacgtctt ccagcgcgat ggcgaggtca gcatcggcgt cacctacatg       420
     accggcgcgc tggtgaagct ggggcagcaa ctggcggtgg cgctgagcgg cgggccgcga       480
     tggaactggc tgccctatct gctgctgtgg ctggggctgg tggcgggcgc tgtggcgggg       540
     ggcggcctct ttgcgctgat gggcctgcat gcgctgtggg tcgccgtggc cttttccggg       600
     ctgttgctgc tgtggagcgg ccgcctggga ccgctggaca agggacgtca agcgctctaa       660
//

If you have problems or comments...

PBIL Back to PBIL home page